Gene ID2940
Gene NameHuta_2940
Annotationconserved hypothetical protein
Locationchromosome:3027952→3028281
Gene typeConserved hypothetical gene
GC content0.6
Hydropathicity-0.618348623853211
DNA (330 bp, Edit)ATGACGCTCGACGCGCTGTCCGACGATGTCACTGCTGAGTACGGTGCACTCGGTGAGGAGATCGCCGTCGATCTGGACCGCGAGACCCGCAACGAACTCGCGATGCTCGAGACCGCCCTCGAACCGGAATCGACCGACGAACTCCTCCGGCGTGCAGTCCACATGCTCTTTCAAAGCACTGTCGACACTGGCACGCTCGACTTCCACCTTCGAAGTAGCTACGACGTCACCTACGATGAGTATCTCTCCGGGATGACTTACGACGAGATGACTGGCGCGAACCAGTTCCCCCAGCAAGGCGATCCCGACGACCGCCGCTACCAGTTTTGA
pI3.7652
MW (k)12426.5
Translation (108 aa, Edit)MTLDALSDDVTAEYGALGEEIAVDLDRETRNELAMLETALEPESTDELLRRAVHMLFQSTVDTGTLDFHLRSSYDVTYDEYLSGMTYDEMTGANQFPQQGDPDDRRYQF