Gene ID2725
Gene NameHmuk_2725
AnnotationThiJ/PfpI domain protein
Locationchromosome:2612742→2613428
Gene typeFunctional gene
GC content0.69
Hydropathicity-0.131140350877193
DNA (687 bp, Edit)ATGACTACCGCACTGTTCATCGTCAGCGAAGAGGGCTACTGGGGCGAGGAGTGTATCGAGCCGCTCACGACGCTCACCGAGGCGGGCGTCGAGGTCACGGTCGCGACGCCGACGGGGAACCCACCCGTGATCGACGAGCGATCGATCGACCCCGAGGAGGTCGGCGAGGAGACCGCCGAACGCGTCACGAGCGTGGCAGAGAGCGACGACCGCCTCAACGATCCGATCGCGCTGGCCGACGCCGACGCCCAAGAGTACGACGCCGTCGTCTTCCCCGGCGGCCACGGTGCCGAGTGGGACGTGACTCAGGACGTACACGCCCGTGACGCGCTCCGTACCGCCGTCGAGGGCGAGGAGGGGACGGCGCTGGTCGTCTGTCACGCTGTCGGCATCCTCGCGTTCACCCGCGACGCCGACGGCGAGTTCCTCGTCGACGGCCGATCAGTCACCGGCTTCCCCAACGCCTGGGAGGAGGGGATCGTCGACGAGCAGGACCTGCTGCCCGACGGCCGCAAGCTCCCGTACTGGGTCGAGGACGAAGTAGTGGCCGCTGGTGGCGTCTGGGACGCCGAACTCGACGCCGACACGTCGGTGACCGTCGACGGCGATCTCGTCACCGCACGAGGGCCGCCCTCCTCACACGCCGCGGCGGTGACGCTACTGGACGAGATCGGGATCGAAGCGTAA
pI3.5899
MW (k)24175.3
Translation (227 aa, Edit)MTTALFIVSEEGYWGEECIEPLTTLTEAGVEVTVATPTGNPPVIDERSIDPEEVGEETAERVTSVAESDDRLNDPIALADADAQEYDAVVFPGGHGAEWDVTQDVHARDALRTAVEGEEGTALVVCHAVGILAFTRDADGEFLVDGRSVTGFPNAWEEGIVDEQDLLPDGRKLPYWVEDEVVAAGGVWDAELDADTSVTVDGDLVTARGPPSSHAAAVTLLDEIGIEA