Gene ID3918
Gene Nameabc11a
Annotationcopper ABC transporter ATP-binding protein
Locationchromosome:1909717→1910463
Gene typeFunctional gene
GC content0.686746987951807
Hydropathicity0.201209677419355
DNA (747 bp, Edit)ATGAGCGACGGCCCCGAAACGCCGACCGACGGCCCCGTGCTGACCGCCGATGGCGTCTCGAAGTCGTTCGGCCCGGTCGACGTACTCTCGGACATCTCCTGTGTCATCCCTGCTGAGGAGGTTGTCGCCATCATCGGCCCGAACGGCAGCGGCAAGACGACGCTGTTGCGGACGCTCGTCGGCGACCTCCGACCGACCGCCGGCGAGGTCACCTACCACGGCCCGTCAGTCGACCGGCCCATCGGCTATCTGCCGCAACGAGCCACATTCCGGTCCGGCTTCAGCTGTGCGGAGACGCTTTCGTTCTACGGGTCGTTCGTCGATGGCCCCGACCCGGCGACGCTGCTGGAACGCGTCGGCCTCGAAGGGGCAGCCGACCGGAACGTCGAAGCCCTCTCCGGCGGGATGCGACGGCTGCTCGGCATCGCACAGGCGATGGTTGGCGACCCGCCGCTCGTCGTCCTCGACGAGCCGGCCAGCGGCCTCGACCCGAACATGAGTGCCAGCGTCTTCGAGACCGCCGGCGAGATGGCCGGCGGCGGAACGACCGTACTGCTCAGCTCACACGACATGTCGCTGGTCGAGGCGGTCGCCGACACCGTGCTGGTTGTCTCACAGGGCGATGTCGTCGCCAGCGGCGCGGTCGCGGAGCTGTACGACCGATTTGAGGTGTCGTCGCTGCGCGGTGTCATCGGGTCGGTCGTCGATGACAGCGACCGCGTCGCGGTGCTGGGGGGTGACGCATGA
pI3.9203
MW (k)25294.4
Translation (247 aa, Edit)MSDGPETPTDGPVLTADGVSKSFGPVDVLSDISCVIPAEEVVAIIGPNGSGKTTLLRTLVGDLRPTAGEVTYHGPSVDRPIGYLPQRATFRSGFSCAETLSFYGSFVDGPDPATLLERVGLEGAADRNVEALSGGMRRLLGIAQAMVGDPPLVVLDEPASGLDPNMSASVFETAGEMAGGGTTVLLSSHDMSLVEAVADTVLVVSQGDVVASGAVAELYDRFEVSSLRGVIGSVVDDSDRVAVLGGDA