Gene ID3302
Gene Name
Annotationhypothetical protein
Locationchromosome:1585712→1586692
Gene typeHypothetical gene
GC content0.623853211009174
Hydropathicity-0.37760736196319
DNA (981 bp, Edit)ATGACTGACGACGACCTTCCGGGCGACGACGTCCTCGACGACGACCTGCTCGAAGACGCGGAGACAGAGGACACGGACCCTAAAACACGTGGAAAGAAAGCCGGCGAGCGAATGCGGCAAAAGACAGAGAACTTTGTCCTCTGGACCGGCGGCGTCGCCGGTGGCCTAACCAGTACCGCGTTCCGCATCGTACCGTTTACCGGTAGGCTGTTCAAGCGGATGGCGGTCAAGAGCATCGAGAACTACCACAAGAAGGCCGGCGGTGACGCGGTCGGTATCGTCGCCAAGGAGGGCCAACAGATCGACCTCATTCCGGTCAAGTACCGAACTCCTGAGGAGGTCGACGAAGGCGAAAAGGCCGGCTGGAAGGCCAAAGGAATCGACAAGGTCTGGAACCCCGGACCGGAAGGCTACTCGGTCAACTACATCGGCCGGACGCCGACAGTGCCGCTGCAGCGCGACGATCACGTCGAAGCCGGCTGGCTCAAACCCCGCATCGGCACGGCCATTGAACTCGACAACTACTGGCCGCTGTTCGTCAACCCGGACATCACCGCAAACATCGACTACGGTGCGGCCGGCGGGTCACAGCGGGCTCGTGCTGACGGTGGTATCAACGATCCGGCAGTGAGCTTCGAGCTCGACTCGCCGGGCGAGTGGGCCGGCGACAACATCATCGATCTCGACAGTGGGGACGGCTACGACGGGATGCGAATCTCGTTCAACAAGGCCAAAGAGTGGCGTGCCGAGACGACGACCTCCGAGTCGATGCAGATGCAGGAGGACCGCGGGTTCCTTCGTGGACGGCTCTCTGGCGACGAAGGGCCGTCGCTGTTCAAGTTGCTGCTGCTCTGTGCCGCCATCATCCTCGGCGTGCTGGCTATCGTCTTGATTGGTCCGCAGCTTGTCGGCGGCGAAGACGGCGGGTCGTCGATGAACCCGCTGCTGGTCAACAGCCTGATGGCCTTCGGGGCGGTCTGA
pI4.3567
MW (k)35291.6
Translation (325 aa, Edit)MTDDDLPGDDVLDDDLLEDAETEDTDPKTRGKKAGERMRQKTENFVLWTGGVAGGLTSTAFRIVPFTGRLFKRMAVKSIENYHKKAGGDAVGIVAKEGQQIDLIPVKYRTPEEVDEGEKAGWKAKGIDKVWNPGPEGYSVNYIGRTPTVPLQRDDHVEAGWLKPRIGTAIELDNYWPLFVNPDITANIDYGAAGGSQRARADGGINDPAVSFELDSPGEWAGDNIIDLDSGDGYDGMRISFNKAKEWRAETTTSESMQMQEDRGFLRGRLSGDEGPSLFKLLLLCAAIILGVLAIVLIGPQLVGGEDGGSSMNPLLVNSLMAFGAV