Gene ID2714
Gene Name
Annotationpeptidoglycan binding protein
Locationchromosome:2010038←2009325
Gene typeFunctional gene
GC content0.471988795518207
Hydropathicity-0.427004219409283
DNA (714 bp, Edit)ATGAGCACAGGTGAGCTGAAGTATCGAGTATCGGCATTCATCAGCATACTCGTGCTCAAGATATCGTCTTTGATACTCACTGAGCTTGGTCATTCAGCTGATCTTATTAGTGGATCACACCAGCACCGATTGAACCGATATTACTTTGAAGACTGCGACGAAGACAGTTTTGTGGAACCGGTCGAGACAACGGACCCAGATGGGGTCGACTACGGATGGGTGATGCAAACGACATTCGTCCTAACAATCATTATTGGTGCGCCAGTCGTGACCGTACTTTCTCTTGGGGCGACACTCCCAACATGGGGAACCCGCGTTGGGTTTGCTATCCGAGTCGGTGCCGTGATTTGGATTCTTACTGCACTCTCTGTATTCGGCTATGCGCGCTGGAGTGATACTAATACTGACACAAATGGAGTTGATACAGAGAGTGTCAATACTCCGTCGGCTTCCTCAGAAAAGAGCACGAGTGATGTCTCCTCGCGCACCCATGTAGACTCACACACAAATACGAATACGAATACGAATACGAATACGAATACGAATACGAATACAAATACAAATACAAATTCAAATTCAGATGCGGATATGGACCCAGACCCAAACCCAGACCCAAGCATAGACATAGATTCACACTCAAATACTGAAACGGGCACGTCGCAGACGACACAACAGAATTCAGACACAACAACGGCTGCTGAGGAGACATCATGA
pI4.0137
MW (k)25566.6
Translation (236 aa, Edit)MSTGELKYRVSAFISILVLKISSLILTELGHSADLISGSHQHRLNRYYFEDCDEDSFVEPVETTDPDGVDYGWVMQTTFVLTIIIGAPVVTVLSLGATLPTWGTRVGFAIRVGAVIWILTALSVFGYARWSDTNTDTNGVDTESVNTPSASSEKSTSDVSSRTHVDSHTNTNTNTNTNTNTNTNTNTNTNSNSDADMDPDPNPDPSIDIDSHSNTETGTSQTTQQNSDTTTAAEETS