Gene ID3120
Gene Name
Annotationhypothetical protein
Locationchromosome:1504613→1504822
Gene typeHypothetical gene
GC content0.60952380952381
Hydropathicity-0.476811594202899
DNA (210 bp, Edit)ATGACCGACGAAGACCCGCCCGAGATTCCGATACTCTGTTCGGAGTGTGACACGAGAACGAAGATTCCGTTTCCGGAGGTCGAAGCGACCGTCGAGCGGCACAATGAACAGCTTCACGACGGCGAGCCGGTCGCACAGGTCGACCCCGCCGTTTTTGACGAACTCGCGGACTTCGTCGCCGAGGACCTCGGCCTCTACGAAGACGCCTGA
pI3.5846
MW (k)7713.42
Translation (68 aa, Edit)MTDEDPPEIPILCSECDTRTKIPFPEVEATVERHNEQLHDGEPVAQVDPAVFDELADFVAEDLGLYEDA