Gene ID1295
Gene NameHuta_1295
Annotationconserved hypothetical protein
Locationchromosome:1269724←1269422
Gene typeConserved hypothetical gene
GC content0.53
Hydropathicity1.282
DNA (303 bp, Edit)ATGTCCTGGCTACCAGCCCTCGTTTTGTTTGGGAGTAGCGTGTTTCCGGTTGGGTATTATCTGAGTTCTCCCGACCGGGACCATGTCGGTCGAACTGGCACGATCAGTGTCCTCATCCCAGTAATCGGATTATTCGTCGGGATTGGTCTGTTGGTCGGGAGCCTCGGCTCGCTCATTTCGAATCCGCTACAGTTAGGTGTGACTGTACTGGGTGTGGTCGAAGTCTTGGTCGTGGTTGGATTCCTCGTTCCGAGAGTGATTGGCGCAACGATCGGGGAGTTTATCGTCAATTCCCTTTTCTAG
pI5.5946
MW (k)10393.4
Translation (99 aa, Edit)MSWLPALVLFGSSVFPVGYYLSSPDRDHVGRTGTISVLIPVIGLFVGIGLLVGSLGSLISNPLQLGVTVLGVVEVLVVVGFLVPRVIGATIGEFIVNSLF