Gene ID2552
Gene Name
Annotationhypothetical protein
Locationchromosome:1235832←1235506
Gene typeHypothetical gene
GC content0.654434250764526
Hydropathicity0.938888888888889
DNA (327 bp, Edit)GTGGGAGGACTCTTGCCGCGGCTCGCGGAGCGCGAACGCGAGGTGTGGATAGCCGCTTTACTACTGTACGGCGTCGGTGACACGGTGACGACGTTCTGGGGGTTGTCGCTCGGCGGTGTCGCCGAAGCCGGGCCGATAGCGAGACCGTTGATTGACGCCTACGGTCGCGGCGCGCTCATTGGCATCAAGGTCGTCGTGTTCCCGACGTTCTACGTCGTCTGGCGGCTGCTTCGGACGCCCGGCCGCGTTGCGGTGCCGCTTGCGCTTGCGGTCGTTGGGGCGGCGGTGACGCTGTGGAACCTCGTTGTTATCTCCGGTGCGTTATAA
pI10.2503
MW (k)11409.6
Translation (107 aa, Edit)MGGLLPRLAEREREVWIAALLLYGVGDTVTTFWGLSLGGVAEAGPIARPLIDAYGRGALIGIKVVVFPTFYVVWRLLRTPGRVAVPLALAVVGAAVTLWNLVVISGAL