Gene ID2500
Gene NamemoaD_2
Annotationmolybdopterin converting factor, small subunit 2
Locationchromosome:1211750←1211469
Gene typeFunctional gene
GC content0.631205673758865
Hydropathicity-0.0860215053763441
DNA (282 bp, Edit)ATGCAGCTTGCACTCCGGTTCTTTGCGACGTTCCGTGAGGCCGTCGGGACGAAAGAAATCGAACGGACATTCGATGCGGAAGCGACCGTCGGCGACGTTCTCGCGGCTGTCGAAGACGAGTTCCCCGAGCTTGCCGGCGACATCCTCGACGACGATGGCGACATCCAGCCGCATTTGACCGTCCTGCGGAACGGCCGGGAGGTCGTCCACCTCGATGGCACTGCGACGGAGCTTTCCGACGGCGACCGGTTGAGCATTTTTCCACCGGTCGCGGGCGGATAG
pI3.9293
MW (k)10042.1
Translation (92 aa, Edit)MQLALRFFATFREAVGTKEIERTFDAEATVGDVLAAVEDEFPELAGDILDDDGDIQPHLTVLRNGREVVHLDGTATELSDGDRLSIFPPVAGG