Gene ID2300
Gene NamenuoI
AnnotationNADH dehydrogenase-like complex, subunit I
Locationchromosome:1118522→1118983
Gene typeFunctional gene
GC content0.588744588744589
Hydropathicity-0.658169934640523
DNA (462 bp, Edit)ATGATCGGAATGCTCAAATCGATGGCAACGACGATGAAGCACGCGCTGGACGGCGAGAAGTTCACCGTCCAGTATCCTGAAGAAACACCGGAGGTGTCGCCGCGGTTCCGCGGTGTCCACAAGTTCTCACAGGAGCGCTGCATCTGGTGTCGCCAGTGTGAGAACGTCTGTCCGAACGACACCATCCAAATCGTCACCGACGATATGCGGAACGGCGAACAGTACAACCTCCACATCGGCCAGTGTATCTACTGCCGGCTCTGTGAGGAGGTCTGTCCCGTCGATGCCATCCTGCTGACCCAGAACTTCGAGTTCACCGGCGACACGAAGGACGACTTGGCCTACAACAAAGAGCAACTCAAGAACGTTCCGTGGTACAAGGACATCGACCCGCTCGCGTCGCGTGAGCCGGACCGCGAAGCGTGGGTCGGCGAGGGCGACGGCGAAGTCGACTACCAGTAG
pI4.3452
MW (k)17733.9
Translation (152 aa, Edit)MIGMLKSMATTMKHALDGEKFTVQYPEETPEVSPRFRGVHKFSQERCIWCRQCENVCPNDTIQIVTDDMRNGEQYNLHIGQCIYCRLCEEVCPVDAILLTQNFEFTGDTKDDLAYNKEQLKNVPWYKDIDPLASREPDREAWVGEGDGEVDYQ