Gene ID2058
Gene Name
Annotationhypothetical protein
Locationchromosome:1000183←1000025
Gene typeHypothetical gene
GC content0.578616352201258
Hydropathicity-0.6
DNA (159 bp, Edit)ATGACCAGACTGCCGGCGGGGCCAAACCGCCGTTACTCCTATCCCGGCATGGGATTCAGAGTTACCGTGTGTCGGAATCCACAACCAGCGGTCCGAAGGGGATTCCTTCAGACGTGGTGTGGCCCGAATCCCGATATTATCCGTTTAACAGGGCGGTGA
pI12.2024
MW (k)5931.92
Translation (51 aa, Edit)MTRLPAGPNRRYSYPGMGFRVTVCRNPQPAVRRGFLQTWCGPNPDIIRLTGR