Gene ID1960
Gene Name
Annotationhypothetical protein
Locationchromosome:956214←955996
Gene typeHypothetical gene
GC content0.657534246575342
Hydropathicity-0.418055555555556
DNA (219 bp, Edit)ATGACGGGCAACGCCTGCCGCTGCGACGGCCCACCTATCCGTCAGACCGACGAATCCAGGCACCTACGGCAGCAACGGAACACCGGCGTCGGTCCCATCTTCCCGCGGTTGGCGGCGGTCATAGCATCAGCGCTCGTAGCCGAGTACGACCCGGCGAACAACAGCCCGTTCGCAAAGCTCATTTGTGCGCGTTCGCAGCGTGGCTGGGCGTCCGGCTGA
pI9.6023
MW (k)7766.8
Translation (71 aa, Edit)MTGNACRCDGPPIRQTDESRHLRQQRNTGVGPIFPRLAAVIASALVAEYDPANNSPFAKLICARSQRGWASG