Gene ID4195
Gene NameHAH_4195
Annotationhypothetical protein
LocationII:177011←177148
Gene typeHypothetical gene
GC content58
Hydropathicity-1.51333333333333
DNA (138 bp, Edit)ATGAGCACTGAACAGCAGTCCGTCGACGAACAGTCTCCAAGCACCAAAGCCGACGACCGACCGGACATTCGTTCCCAGCACCAACGAGCACAGACGAGTGGCGAAGTTTTTGCGGGTCGTTCCCGTGGTGGGCAATGA
pI5.7096
MW (k)4947.22
Translation (44 aa, Edit)MSTEQQSVDEQSPSTKADDRPDIRSQHQRAQTSGEVFAGRSRGGQ