Gene ID1954
Gene Name
Annotationhypothetical protein
Locationchromosome:955195←954878
Gene typeHypothetical gene
GC content0.638364779874214
Hydropathicity-0.796190476190477
DNA (318 bp, Edit)GTGCTCTCCAACTCAGTAGACACCGACACGGCGAAACGCAGCCTCGTTGAGACGTACGACCCGCCAAACTACGACGACCCGTGGGACGCTGTCGAAGACTACGAACGTGTCCAGCGGTACACAGCTAAGCACCCACAGCAGGGGTCGCAAGCAGTCAGCACGGCGGTCGACCTCCCGCGGGGCCGCATCCGGTCGTGGGTTGACGGCGACGGGATGCCGGACTGCTACCGCTGCCTGCAAACGGCGCTGGAAAACGGCTGGATACTCAATGGGTGGGAGGACGACACAGCCCGCTCAATGACGACGCTGGCGGCATAG
pI4.1747
MW (k)11857
Translation (104 aa, Edit)MLSNSVDTDTAKRSLVETYDPPNYDDPWDAVEDYERVQRYTAKHPQQGSQAVSTAVDLPRGRIRSWVDGDGMPDCYRCLQTALENGWILNGWEDDTARSMTTLAA