Gene ID1866
Gene Name
Annotationhypothetical protein
Locationchromosome:905730←905563
Gene typeHypothetical gene
GC content0.601190476190476
Hydropathicity0.118181818181818
DNA (168 bp, Edit)ATGCGTGGGACGTTCTTCGGGACGGACCTCGACATCGTGTTCACCGTCGAACCGGACCGAATCGTGGTCGTGACACAGATGTCACAGCACGCCAACAGCCTCCGTGGACACTTCTACGAGCAGGTCGGGACGACCGCAGCAGACGCAGTAGCCGCAGTATCGAACTAG
pI4.6956
MW (k)5971.67
Translation (54 aa, Edit)MRGTFFGTDLDIVFTVEPDRIVVVTQMSQHANSLRGHFYEQVGTTAADAVAAVSN