Gene ID1824
Gene Name
Annotationhypothetical protein
Locationchromosome:883887→884120
Gene typeHypothetical gene
GC content0.611111111111111
Hydropathicity0.280519480519481
DNA (234 bp, Edit)ATGTCACAGGGCGAGTCGAACGACGCCGAGAAAGACTCCGGGTCTCTCAAAGAGGGGCTCTCCGAATCCGCCGGGGACCCGCGGGTCCACTTGGTGATGAACCTGCTACTGTCGGCGATGTTCGTCTACACCCTGCTGTGGGGGCTGGACTTCCTTGGGACGCTCGAGTTCACTCGCCTCAGATTCGCCTTCGGGACCGTCGTTATGATGGGGCTGACGCGGACGCTCATTTGA
pI4.5848
MW (k)8486.84
Translation (76 aa, Edit)MSQGESNDAEKDSGSLKEGLSESAGDPRVHLVMNLLLSAMFVYTLLWGLDFLGTLEFTRLRFAFGTVVMMGLTRTLI