Gene ID4089
Gene NameHAH_4089
Annotationhypothetical protein
LocationII:80077→80592
Gene typeHypothetical gene
GC content52
Hydropathicity0.0801169590643273
DNA (516 bp, Edit)ATGCAAATTGCGACGAAAATTTGGGATAGTGGGTGGGGAGCAGTCTTCCTAACCGTCTACACAGGCGTGGCCATTCAACTCGTCAGGCCAGAACCACTCTTCCTGAAAACACTGTCCGTCCTCCCAACAATACTGGTCATGTTCCTAGCCGATCAGCAGAACAACCGGCTAATCAACTTCTTCGCCGGAGGCGAACTGAGACGGTCCACAGACCAAATACAGAAAATCACGGGACACGACGACTTCTACGAATCCGCTTCCGAAGAACTCCAGAACCGAGTGGATGACTTCGACCGCCGCGCTTACCAGAAGAATATCTCTATCCTCGCAGGCTTGATTATTGCCTTGACCACTCCCTTCGTCGGGTTCTACCTCGGTGGTACTTTCGGACTGGGTATTGGGCTGGTCATCGGCCTTCTCGCTACTCAACTCCTGACCCGGCGGAGTATCCAGGAACTCAACAGACTCGCACAGAACATCAGTGAGCCGTATACAGCCAAATATGAAAATCAGTAG
pI5.9068
MW (k)19188.1
Translation (170 aa, Edit)MQIATKIWDSGWGAVFLTVYTGVAIQLVRPEPLFLKTLSVLPTILVMFLADQQNNRLINFFAGGELRRSTDQIQKITGHDDFYESASEELQNRVDDFDRRAYQKNISILAGLIIALTTPFVGFYLGGTFGLGIGLVIGLLATQLLTRRSIQELNRLAQNISEPYTAKYENQ