Gene ID1637
Gene NamenuoA
AnnotationNADH dehydrogenase, subunit A (ubiquinone)
Locationchromosome:777382→777795
Gene typeFunctional gene
GC content0.483091787439614
Hydropathicity0.678102189781021
DNA (414 bp, Edit)ATGAGTGAATGGATCGCAGTCGGTGCACTCGGACTTGTCGCTGTTGGCATCCCACTTGGGATGATGGCTATATCAGCGATCCTTCGTCCGACTGTCCCCGAACAAGGAAAGAGCGCTACGTATGAGAGCGGTGAGATTCCAACTGGATCAGCACGCGTTCAATTTAATATCCAATATTACATGATTGCGCTGCTGTTTCTTGTATTTGATGTCGAAACTGTACTCATACTCCCGTGGACCGTTATCTATCGGCCCGCATTAGAAGCCGGCGCAGATCTTACCACGGTGTTGCTTCCAATGCTTGTGTTTATTGGTATCCTCATCGTCGGATTAGTCTGGGCATGGCGGAATGGCGCTGTTAAGTGGATCAAAAGTCCACTCGCAAACCGTCAAAAAACAGAACGAGATATATGA
pI6.8038
MW (k)15026.9
Translation (136 aa, Edit)MSEWIAVGALGLVAVGIPLGMMAISAILRPTVPEQGKSATYESGEIPTGSARVQFNIQYYMIALLFLVFDVETVLILPWTVIYRPALEAGADLTTVLLPMLVFIGILIVGLVWAWRNGAVKWIKSPLANRQKTERDI