Gene ID2177
Gene NameHAH_2177
Annotationhypothetical protein
LocationI:2103262←2103513
Gene typeHypothetical gene
GC content62
Hydropathicity-0.471084337349397
DNA (252 bp, Edit)ATGAGTCAATCTACAGACCTTCCAGACCCGGACCCGGAACAGCTCCGCCTGGCCGTTGAACGGTTGCTCGACGAGACGGTCGACCGCGACGAGGCGCTCCACGTCACGGCCGACGATATTTCGGTCTCTATTCCGATGCGGTTCGGTTCGGACTCCCCGCAAGCGACGTGGCGGTTCGACGGCGACGTGACGATCTCAGTCGACGGTATTCGGGGGCCGCTCAGAGAGTGGGTCGACCTCCTCGAAGAATAG
pI3.8253
MW (k)9337.28
Translation (82 aa, Edit)MSQSTDLPDPDPEQLRLAVERLLDETVDRDEALHVTADDISVSIPMRFGSDSPQATWRFDGDVTISVDGIRGPLREWVDLLEE