Gene ID2168
Gene NameHAH_2168
Annotationhypothetical protein
LocationI:2097586←2098245
Gene typeHypothetical gene
GC content70
Hydropathicity0.712328767123287
DNA (660 bp, Edit)ATGGACCGCCTCGCGAAGCGACAACTGGTCGGGACTGCCGGGCTGGTGGTAGTCGTCGCCGTCGCGACAACGCTGCTCACCCCCGAGCGGGTGGTAGCCCAGACGACGCATCTCGCCGACCACCCTGTCTACCTCGCGGGCGTCATCGTCGGGCTGTACCTAGTTCGCCCGTTCTTCGCGTGGCCGACGATGCCGCTGTCCGCGTTCGTCGGGTTCGTCCTCGGCGTCAAATACGGCTTCCCGGTCGCACTGATGGGCGCACTCGTCACCTGCCTCATCCCCTACCGGTTCGCGCTCCGGGCCGGCGAACAGGGCGGGATGTTCGGCTGGCTGGGGGACTCAGGCCGCCGGATTATCGAGGTGACCGGCGAGACGCGGGGGGTGCTCGCGGCACGGCTCTCACCGGTGCCTGCGGACCCCGTCTCTTATGGAGCCGGGTTCGCCCGCGTCTCGCCGCGCTCCTTTGCGGTCGGGACGTTCCTCGGCGAGATTCCGTGGGTCGCGGTCGAGGTCACCGCGGGCGCGTCGCTGCGGTCGCTGACGCTCACGGGGCTCAGTGTCGACGCGCTCCCGCACGTCCTGTTGTTCTCCGCGGCACTGGCTGTGCTGGTACTCGCCGGCCCGGCTTACCGCCATGTCAGCGCTCCGAACTCGTCGTGA
pI10.0227
MW (k)22941
Translation (218 aa, Edit)MDRLAKRQLVGTAGLVVVVAVATTLLTPERVVAQTTHLADHPVYLAGVIVGLYLVRPFFAWPTMPLSAFVGFVLGVKYGFPVALMGALVTCLIPYRFALRAGEQGGMFGWLGDSGRRIIEVTGETRGVLAARLSPVPADPVSYGAGFARVSPRSFAVGTFLGEIPWVAVEVTAGASLRSLTLTGLSVDALPHVLLFSAALAVLVLAGPAYRHVSAPNSS