Gene ID1607
Gene NameHAH_1607
Annotationhypothetical protein
LocationI:1544927←1545190
Gene typeHypothetical gene
GC content54
Hydropathicity-0.325287356321839
DNA (264 bp, Edit)ATGCTCAGTATCGACATCGACCAGTTCATGCTGGAACTCAAAGATGGAGCGTTCAAGAGCGTCGGCCCGTCGAACAAGGAAGCGACGATCAAGATGTACGACGTGGAGGGTGTCGACGTTCGCGAGTACGGCGACAAGCGCGTGAAAATTGCCTTCGAAGACGAACAGGGAAGCGAAATCGAGGTCGCTCTGTTTCCTGAACAGGCGAAAGCGGTCGCTTCAGGGCTCGAACTACTGGAAGAAGAGAGCGAGATGTTCGAATAG
pI3.9024
MW (k)9764.97
Translation (86 aa, Edit)MLSIDIDQFMLELKDGAFKSVGPSNKEATIKMYDVEGVDVREYGDKRVKIAFEDEQGSEIEVALFPEQAKAVASGLELLEEESEMFE