Gene ID1605
Gene NameHAH_1605
Annotationcupin 2 barrel domain-containing protein
LocationI:1542135←1542623
Gene typeFunctional gene
GC content65
Hydropathicity-0.716666666666667
DNA (489 bp, Edit)ATGAGCGACGGCCCCGTCAACGAAGCCGACCTCGACTGGACCGACCACGACCACGGCGACCGGACGTTCAGGCGCAAGCAGCTTGGTGACGCCGCCGGGGGCGAACAACTCGGCGCGAGCCTCTATGCCGTCCCACCGGGGAAACGGCTCTGGGTGCGCCACTACCACGAAGGCAACGAGGAAGCGATATTTGTCCAGGCCGGGACCGGCACGCTCTGGCTCGGCCCCGACGCTGAGGAACACGCACTCAAGCCGGGCGATTTCGTCGCGCTTCCGGCCGGCGAGGAGAGTGCGCACGAAATCGAAGCCGGCGAGTCTGAACTCCGACTGTTGATGGTTTCGACGATGGAGGAACCGGATATCACCGTCTACCCCGACCGGGAGATGGTCGGGCTGTACGCCGGGTCACCGCCGGGCGGCGAGAAGGCGGACCGGACGTTGTCGACGTATCTCGACAGGAACGCGGAAAAAGAGTACTGGGAGGAGTGA
pI4.1899
MW (k)17895.6
Translation (161 aa, Edit)MSDGPVNEADLDWTDHDHGDRTFRRKQLGDAAGGEQLGASLYAVPPGKRLWVRHYHEGNEEAIFVQAGTGTLWLGPDAEEHALKPGDFVALPAGEESAHEIEAGESELRLLMVSTMEEPDITVYPDREMVGLYAGSPPGGEKADRTLSTYLDRNAEKEYWEE