Gene ID797
Gene NameHAH_0797
Annotationhypothetical protein
LocationI:756456→756689
Gene typeHypothetical gene
GC content61
Hydropathicity0.616883116883117
DNA (234 bp, Edit)ATGACGGGATATTACGACATCATTCTTGGACTCATTCCGCTCGCCATGGCCGGCATCACCGCCTCTCTGTTCGTTGTCGGCTTCGAACTGACGACGGCGATTCCGCTGGCCTCTGTCGTAACAGTCGGCCTCATCGGCCACGCGATGTTCGTCCGTGCCCCCGTCGACCCGGTTCCAAACGACACGTCGACCCAACAGAGCCCGCAGTCGGACCCGCTACAGACTGCGGACTAG
pI3.7582
MW (k)8016.27
Translation (76 aa, Edit)MTGYYDIILGLIPLAMAGITASLFVVGFELTTAIPLASVVTVGLIGHAMFVRAPVDPVPNDTSTQQSPQSDPLQTAD