HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0098COG0547KOG1438arCOG02012Anthranilate phosphoribosyltransferasephosphoribosyl transferase

HOG Organism Gene ID Name Annotation
cHOG0098 nrc1 VNG1912 trpD2 phosphoribosyl transferase
cHOG0098 hmu HMUK1586 Hmuk_1586 Anthranilate phosphoribosyltransferase( EC:2.4.2.18 )
cHOG0098 hma RRNAC3306 trpD1 anthranilate phosphoribosyltransferase
cHOG0098 hwa HQ3122A trpD anthranilate phosphoribosyltransferase
cHOG0098 hla HLAC0088 Hlac_88 glycosyl transferase family 3
cHOG0098 hbo HBOR06610 Hbor_06610 anthranilate phosphoribosyltransferase( EC:2.4.2.18 )
cHOG0098 hut HUTA1762 Huta_1762 Anthranilate phosphoribosyltransferase
cHOG0098 hvo HVO_2226 HVO_2226 trpD anthranilate phosphoribosyltransferase
cHOG0098 nph NP0532A trpD_2 homolog to anthranilate phosphoribosyltransferase
cHOG0098 nph NP3062A trpD_3 homolog to anthranilate phosphoribosyltransferase
cHOG0098 hhi 543 trpD1 anthranilate phosphoribosyltransferase
MUSCLE (3.6) multiple sequence alignment


532|gene|nph        MLTEK----QEFGDWPLKRLMTEVVGTGIKSAEDMSREQATDAFRRIVAGEPDETTLGAF
1912|gene|nrc1      MA-------DEYGEWPLKRLNTEVVASGPKSAGDMDREQAREAFQRILDLKPDQTTLGAF
3062|gene|nph       MAATS----ETYGEWPLKRLMTEVVGSGHKSADDMTREQASDAFRRILDGEPDETTLGAF
1762|gene|hut       M--------SDYGEWPLKRLMTEVVGSGTKSAEDMTREQATEAMERILDDEPDPTTLGAF
3122|gene|hwa       MAKASEAVESEFGEWPLKRLMTEVVGSGVKSAEDMSREQATDAIRRILANEPDQTTLGAF
6610|gene|hbo       MAQAPES--PEFGEWPLKRLMTEVVGTGVKSAEDMTREQATEAMQRILAGEPDHTTLGAF
88|gene|hla         MAQAT----QEFGDWPLKRLMTDVCGSGHKSADDLTRAQATEAFERILADEPDPTTLGAF
13306|gene|hma      MAQAT----REYGEWPLKRLMTEVVGSGHKSADDMSRTQAREAFQRILGDEPDHTTLGAF
543|gene|hhi        MAQAT----REYGEWPLKRLMTEVVGSGHKSADDMSRTQAREAFRRILGDEPDHTTLGAF
                    *          :*:****** *:* .:* *** *: * ** :*: **:  :** ******

532|gene|nph        WLANRWKRNTPEELAAFLDVML-ESVERAEPKADPVDCGANYDGKAETAILGVAAGAVAA
1912|gene|nrc1      WLANRWKKNNPEELGAYVDVMYEESRHTAAPDADPVDCGANYDGKARSAVLGVAAGIVAA
3062|gene|nph       WLANRWKRNTPEELAAYVDVMD-EGIESAAPECDPVDCGANYDGKGRSALLGVASGLVAA
1762|gene|hut       WLANRWKHNTGEELAAYVDAMA-DRVETGVPDVDPVDCGANYDGKERTAILGVAAGVVAA
3122|gene|hwa       WLANRWKHNVAQELSAYADVVA-EDVITAVPDADPVDCGANYDGKGDTAILGAAAGIVAA
6610|gene|hbo       WLANRWKHNNAEELAAYTDVMC-EHVEYAEPDADPVDCGANYDGKGKTAILGAAAGIVAA
88|gene|hla         WLANRWKRNTAEELGAYVDVMC-ERVEYAEPDADPVDCGANYDGKGRSAILGVAAGVVAA
13306|gene|hma      WLANRWKRNTPEELGAYVDVMSEESVETATPEADPVDCGANYDGKGRSAILGVGAGVVAA
543|gene|hhi        WLANRWKRNTPEELAAYVDVMSEESVETAAPDADPVDCGANYDGKGRSAILGVAAGVVAA
                    *******.*  :**.*: *.:  :    . *. ************  :*:**..:* ***

532|gene|nph        GAGTPVVVHGGDRIPSQKSPAYKDVLDELGVTTELDPEESAAMVDETGFGFYFQPAFNPA
1912|gene|nrc1      AAGTPIVVHSGDHVPSQKEVAYKHVLDALGVRTELTPEASARMVDEHGFGFYYQPAFNPT
3062|gene|nph       AAGTPVVVHSGDRVPTQKQDAYKHVLDELGVRTELAPAESASMTDTVGFGFYYQPNFAPE
1762|gene|hut       AAGTPVVVHSGDRVPTQKNDAYKHVLDELGVRTVLRPAKSAAMVEETGFGFYYQPAFNPA
3122|gene|hwa       GAGTPVVVHSGDRVPTQKQDAYKHVLDELGIQTEIEPVESAAMVDETGFGFYYQPAFAPH
6610|gene|hbo       GAGTPVVAHSGDRVPTQKQDAYKHVLDELGIRTELSPEESADQVDETGFGFYYQPAFNPV
88|gene|hla         AAGTPVVVHSGDRVPTQKQDAYKHVLDELGVHTELTPSDSADMVDETGFGFYYQPAFNPA
13306|gene|hma      AAGTPVVVHSGDRVPTQKQDAYKHVLDELGVRTEIEPSESADMVDEVGFGYYYQPEFNPG
543|gene|hhi        AAGTPVVVHSGDRVPTQKQDAYKHVLDELGVRTEIEPSESADMVDEVGFGFYYQPAFNPG
                    .****:*.*.**.:*:**. *** *** **: * : *  **  .:  ***:*:** * * 

532|gene|nph        IDDLYDRRDEMGVRTFVNTIETLANPAGASVHLGSFYHLTFAEKVIDTIRAAERSRFDRA
1912|gene|nrc1      VDALWDRRDKMGVRTFVNTVETLANPADAAVHLGSFYHLAFAEKMVETVRESEHAGFERV
3062|gene|nph       VAGLEDRRDQMGVRTFVNTIETLANPADASVHLGSFYHLPYAKRLINTFDAAETATVDRV
1762|gene|hut       VDDLFDRRDQMGVRTFINTVETLANPAGASVHLGSFYHLSFAKKVVETFERSEAHYLDRV
3122|gene|hwa       INGINDRRDKMGVRTFFNTIETIMNPAKADVHLGSFYHLAFAKKMVDTFKKMETQHPHRV
6610|gene|hbo       IHDLWERRDQMGVRTFVNTIETIANPAKADVHLGSFYHLAFAKKVVDTFEQSEQLSPRRV
88|gene|hla         IDDLFDRRDQMGVRTFVNTIETLANPAGASVHLGSFYHLAFAKKVVDTFVESEFHDLDRV
13306|gene|hma      IDALFERRDNMGVRTFVNTVETLANPANASVHLGSFYHLAFAKKMVRTLAQSETSSVERA
543|gene|hhi        IDALFERRDNMGVRTFVNTVETLANPANASVHLGSFYHLAFAKKMVRTLARSETSSVERA
                    :  : :***:******.**:**: *** * *********.:*:.:: *.   *     *.

532|gene|nph        ILFQGMEGYDDIRPGYTKVAEWADDGALD----------DVMNDYEIETAELGMDFEYDD
1912|gene|nrc1      LMFQGLEGYDDVRPGSTTVAEWDAG--------------SDLADFTIETPEYGMDFETED
3062|gene|nph       VMFQGMEGYDDVRPGSTKVAVWNEG--------------KDIDDFDIETPNYGMDFEGED
1762|gene|hut       IMFQGMEGYDDIRPGYTKFAEWTEA--------------EGLASDEIETGAYGMDFETDD
3122|gene|hwa       LMFQGMEGYDDIRPGYTKVGEWTDG---------------EFIDYEIETPEYGMDFEYED
6610|gene|hbo       VMFQGMEGYDDIRPGYTKVGESTDG---------------EFTDFEIETAEYGMDFETED
88|gene|hla         LMFQGMEGYDDVRPGYTKVAEWDAAGGDGDEAGDAGSEGASFDDFEIETAKYGMDLEEED
13306|gene|hma      LFFQGMEGYDDVRPGETIVAEWPVTGEESDD--------EDIADFEIRTGEYGMDIESED
543|gene|hhi        LFFQGMEGYDDVRPGETVVAEWPVTGEESDD--------EDIADFEIRTGEYGMDIESED
                    ::***:*****:*** * ..                     : .  * *   ***:* :*

532|gene|nph        LAV--DDIAADSAAITEAVLTGERTDQFRDAVLLNGAFRIYAGGDADSFEAGLDAAERAL
1912|gene|nrc1      LHV--EDVAADSATITKDVLSGERTDQFHDAVLVNAALRLYARTDVDTLDEGIEAAERVI
3062|gene|nph       LAV--DDVAADSAAITESVLAGERTDEFADAVAVNAALRIYAGGDADDIDAGLDAAREAL
1762|gene|hut       LSV--EDVAGDSARLTREVLTGDRTDLWHDAVALNAAVRIYAGGNVDTLDAGLDAARTAI
3122|gene|hwa       LEVNPDDVAGDSAKLTREIISGNRTDYFVDAVALNAAFRIYARDDAETIETGLEMAHESI
6610|gene|hbo       LEVDPDDVADDSAEITESVITGDRDDHFADAIELNAAFRIYAREDAETLEEGLEMARESI
88|gene|hla         LAV--DDVAVESAEITEAVLTGERDGPFADAVAVNAALRIYAREDADSIEDGLDAARAVI
13306|gene|hma      LQV--DDVAEESAAITEAVLAGEREDGFADAVALNAALRIYAREDADSIQDGLEQAREAI
543|gene|hhi        LQV--DDIAEESAAITEAVLAGEREDGFADAVALNAALRIYAREDANSIQDGLEQAREAI
                    * *  :*:* :** :*  :::*:* . : **: :*.*.*:**  :.: :: *:: *   :

532|gene|nph        DDGSAAAVLTDLQSF
1912|gene|nrc1      SDGTAEALLADLRAF
3062|gene|nph       ESGAAAERLSTLQSF
1762|gene|hut       DNGSAAAVLENLRGF
3122|gene|hwa       ESGSAAAVLEDLQAF
6610|gene|hbo       ESGAAEAVLEDLREF
88|gene|hla         DDGSAHDVLEALRDF
13306|gene|hma      ADGSAAATLDELRTF
543|gene|hhi        ADGSAAEILDDLRAF
                     .*:*   *  *. *