HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0097COG0334KOG2250arCOG01352Glutamate dehydrogenase/leucine dehydrogenaseglutamate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0097 nrc1 VNG0628 gdhA1 glutamate dehydrogenase
cHOG0097 hmu HMUK3134 Hmuk_3134 Glu/Leu/Phe/Val dehydrogenase( EC:1.4.1.3,EC:1.4.1.4 )
cHOG0097 hmu HMUK3114 Hmuk_3114 Glu/Leu/Phe/Val dehydrogenase( EC:1.4.1.4,EC:1.4.1.3 )
cHOG0097 hma RRNAC0775 gdhA2 NAD(P)-specific glutamate dehydrogenase
cHOG0097 hwa HQ1880A gdhA glutamate dehydrogenase (NADP+)
cHOG0097 hla HLAC0802 Hlac_802 Glu/Leu/Phe/Val dehydrogenase
cHOG0097 hbo HBOR17850 Hbor_17850 glutamate dehydrogenase (NADP)( EC:1.4.1.4,EC:1.4.1.3 )
cHOG0097 hut HUTA0589 Huta_0589 Glu/Leu/Phe/Val dehydrogenase
cHOG0097 hvo HVO_1453 HVO_1453 gdhA Glutamate dehydrogenase
cHOG0097 nph NP1582A gdhA_2 glutamate dehydrogenase 2
cHOG0097 hhi 1424 gdhA2 glutamate dehydrogenase (NAD(P)+)
cHOG0097 hhi 5030 gdhA3 NAD(P)-specific glutamate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


5030|gene|hhi       -MSDVNPYQSLRTQIDAAAQYLDISEGQLERLKTPERILETNLSVEMDDGSVEVFRAYRS
589|gene|hut        MSNSVNPFESLQSQIDDASASLDAGDDVLESLKHPQRVLETTLTVEMDDGSLETFKAFRS
1880|gene|hwa       MTSEANPFESLQEQIDDASAYLDVRSDLVERLKRPERVLEANLSVEMDDGTIEHFKSFRS
628|gene|nrc1       ----------------------------------------------MDDGTIETFKAFRS
17850|gene|hbo      MSEEANPFESLQEQIDDAAAFLDVEDDVVERLKHPERVLELNLSVDMDDGTRKRFKAFRS
802|gene|hla        MTGQANPFESLQEQVDDAAAFLDASPGVLDRLKNPERVLETNLTIERDDGSLETVRAYRS
1582|gene|nph       MAEDVNPFESLQEQIDDAAEHLDVGDDVVERLKNPERVLETNLSVELDDGSIGVFRAYRS
10775|gene|hma      MSPEVNPFESLQEQIDDASDYLEYSTDVLERLKHPERVLETNLSVEMDDGSVEVFRAYRS
1424|gene|hhi       MSPEVNPFESLQEQIDDASDYLEYSTDVLERLKHPERVLETNLSVEMDDGSVEVFRAYRS
                                                                   ***:   ..::**

5030|gene|hhi       QFNGDRGPYKGGIRYHPQVDRDEVKALSGWMVYKTATGDIPLGGGKGGIVIDPSNYSESE
589|gene|hut        QFNDARGPYKGGIRYHPGVNRDEVKALSGWMVYKCATVGIPLGGGKGGIVIDPSEYSESE
1880|gene|hwa       QFNGDRGPYKGGIRYHPGVTRDEVKALSGWMVYKCALVDIPYGGGKGGIAVDPSRYSAGE
628|gene|nrc1       QFNGDRGPYKGGIRYHPGVTRDEVKALSGWMVYKTAVADIPYGGGKGGIILDPEEYSDSE
17850|gene|hbo      QFNGDRGPYKGGIRYHPNVSRDEVKALSGWMVYKCAVVDIPYGGGKGGIVIDPREHSAAE
802|gene|hla        QFNGDRGPYKGGIRYHPGVTRDEVKALSGWMAYKCAVVDIPYGGGKGGIAIDPADYSEDE
1582|gene|nph       QFNGDRGPYKGGIRYHPDVDRDEVKALSGWMVYKCAVVDIPYGGGKGGIVIDPREYSTDE
10775|gene|hma      QFNGDRGPYKGGIRYHPQVTRDEVKALSGWMVYKCAAVNIPYGGGKGGIEIDPRQYSASE
1424|gene|hhi       QFNGDRGPYKGGIRYHPQVTRDEVKALSGWMVYKCAAVNIPYGGGKGGIEIDPRQYSADE
                    ***. ************ * ***********.** *  .** ******* :**  :*  *

5030|gene|hhi       LERVTRSFAKELTPLIGADRDVPAPDVNTGQREMNWIKDTYETLENTTEPGVITGKDLAS
589|gene|hut        LERITRAFAVELRPLIGEDRDVPAPDVNTGQREMNWIKDTYETLENTTEPGVVTGKSLDS
1880|gene|hwa       LERLTRSFATELRPLIGPDVDIPAPDVNTGQREMDWIKDTYETLENTTAPGTVTGKSLSA
628|gene|nrc1       LERITRAFATELRPFIGEDKDVPAPDVNTGQREMNWIKDTYETLEDTTAPGVITGKALEN
17850|gene|hbo      LERITRSFAKELRPLIGEDQDIPAPDVNTGQREMNWIKDTYEKLEHKTAPGVVTGKAISS
802|gene|hla        LERLTRAFATELRPLIGEDRDIPAPDVNTGQREMNWIKDTYETLENTTAPGVITGKALDS
1582|gene|nph       LERITRAFAEELRPLIGEDRDIPAPDVNTGQREMNWIKDTYETLENTTAPGVITGKAIES
10775|gene|hma      IERITRSFAKELRLIIGEDRDIPAPDVNTGQREMNWIKDTYETLENTTEPGVITGKAPES
1424|gene|hhi       IERITRSFAKELRPIIGEDRDIPAPDVNTGQREMNWIKDTYETLENTTEPGVITGKAPES
                    :**:**:** **  :** * *:************:*******.** .* **.:***    

5030|gene|hhi       GGSEGRVEATGRSTVVAAREAFEYLDKDLEGATVAVQGYGNAGWIAAKLI-HQMGANVVA
589|gene|hut        GGSEGRVEATGRSSMLVAREAFSYLDRDISEATVAVQGYGNAGWITADLL-EDLGASIVA
1880|gene|hwa       GGSAGRVRATGRSTMLTAREAFTYRGRDIADATIAVQGYGNAGSVAAELL-EDQGATVVA
628|gene|nrc1       GGSEGRVNATGRSTMFAAREVFDYLDRDLSDATVAVQGYGNAGSVAAKLI-ADQGADVVA
17850|gene|hbo      GGSEGRVEATGRSTMLTAREAFDYLDKDIEGATVAVQGYGNAGSVAANLL-EDIGANIVA
802|gene|hla        GGSEGRVEATGRSVALSAREAFDWLDRDIAGATVAVQGYGNAGSIAAALL-ADLGADVVA
1582|gene|nph       GGSRGRVEATGRSTMLTAREAFDYLGKSLPGASVAVQGYGNAGSIAAKLLQDDHGANIVA
10775|gene|hma      GGSAGRVEATGRSVMLTAREAFDYLGKDIEDATVAVQGYGNAGSVAAKLI-EDLGANIVA
1424|gene|hhi       GGSAGRVEATGRSVMLTAREAFDYLGKDIEDATVAVQGYGNAGSVAAKLI-EDLGANIVA
                    *** *** *****  . ***.* : ...:  *::********* ::* *:  : ** :**

5030|gene|hhi       VSDSSGAIYSEASFDPVAVKDYKRETGSVVGYPDAAEEL-TNEELLTLDVDLLIPAALEN
589|gene|hut        VSDSSGAIRTDGEFDARAVKDHKRETGSVVGYAGADEEL-TNDELLTLDVDILVPAALEN
1880|gene|hwa       VSDSSGAIYDPTGLDTRAVKSHKRKTGSVIEYEGAETEIRSNRELLTLDVDVLIPAALEN
628|gene|nrc1       VSDSSGAVHNPDGLDTRAVKAFKTETGSVSGYEGATEEL-SNEALLTMDVDLLVPAALEN
17850|gene|hbo      VSDSSGAIYREGGFDTAAAKQFKRETGSVSGYDQADEEM-TNEELLTLDVDLLIPAALEN
802|gene|hla        VSDSSGGIHAPDGLDPRAVKAHKVETGSVSGYSD-TESL-TNEELLTLDVDLLVPAALEN
1582|gene|nph       VSDSSGAVYNPSGLDAHDVKAFKNETGSVSGYDDATEEL-TNEELLTLDVDLLVPAALEN
10775|gene|hma      VSDSSGAVYNPDGLGARDAKAFKSETGSLAGYEGATEEL-TNEELLTMDVDLLVPAALEN
1424|gene|hhi       VSDSSGAVYNSDGLDARDAKAFKSETGSLAGYEGATEEL-TNEELLTMDVDLLVPAALEN
                    ******.:     :..  .* .* :***:  *     .: :*  ***:***:*:******

5030|gene|hhi       AIDEPLAHDISADVISEAANGPITPAADDVLSDRETLVIPDILANAGGVIVSYFEWVQNR
589|gene|hut        AIDEELAADVTADVIVEAANGPLTPKADEVLADEDVLVIPDILANAGGVTVSYFEWVQNR
1880|gene|hwa       AIDESIAVDVSADVIVEAANGPLTPDADAVLTDRDVAVFPDVLANAGGVTVSYFEWVQNR
628|gene|nrc1       AIDEDLAHDVDADVVVEAANGPLTPDADDVLTERGVTVVPDILANAGGVTVSYFEWVQNR
17850|gene|hbo      AIDGELAQDVQADVVVEAANGPLTPEADDELTGRDVYVFPDILANAGGVTVSYFEWVQNR
802|gene|hla        AIDGDLAADVSADVIVEAANGPLTPDADDVLAEKDVYVVPDILANAGGVTVSYFEWVQNR
1582|gene|nph       AIDADLAADVQADIIAEAANGPLTPAADDILTEKDVLVIPDILANAGGVTVSYFEWVQNR
10775|gene|hma      AIDGDLARDVQADIVVEAANGPLTPNADDVFTERDVAVFPDILANAGGVTVSYFEWVQNR
1424|gene|hhi       AIDGDLARDVQADIVVEAANGPLTPNADDVFTERDVAVFPDILANAGGVTVSYFEWVQNR
                    ***  :* *: **:: ******:** **  ::   . *.**:******* **********

5030|gene|hhi       QRFYWSEERVNEELDSIIVDQFGNLVDAYEERNLPSLRTAAYVVALQRVMNAGEQRGTWP
589|gene|hut        QRNYWSEERVNEELEDVIVTAFDDLVSAYEDEDLATLRVAAYVVALRRVLSASEQAGHWG
1880|gene|hwa       QQFYWAESRVKQELETIITNAFDDLVEAYESRELPNFRTAAYAVAIERVIEAYDRQGTWP
628|gene|nrc1       QRFQWTEDRVNEELEAIITDAFDAMTDAHEDAGTPNLRTAAYVVAVQRVVDAYEGSGSWP
17850|gene|hbo      QRFYWTEERVNDELERVITEAFDNLVEAYDSHDLPNFRTAAYVVAIQRVVDAYSDNGNWP
802|gene|hla        QRFYWTESRVNEELERMIVDAFDRLVDSYETNDAPNLRTAAYVVAIDRIINAYDQAGNWP
1582|gene|nph       QRFYWTEERVNEELERHIVEAFDGLIDCYEERDLPNLRTAAYVVALRRVLSAYDEAGSWP
10775|gene|hma      QRFYWSEERVNDELETIITNAFDDLVETYEETGAPNFRTAMYVVAIQRVVAAAEEGGIWP
1424|gene|hhi       QRFYWSEERVNDELETIITNAFDDLVETYEETGAPNFRTAMYVVAIQRVVAAAEEGGIWP
                    *.  *:*.**::**:  *.  *. : . ::    ..:*.* *.**: *:: * .  * *