HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0096COG1916arCOG02142/3Uncharacterized homolog of PrgY (pheromone shutdown protein)possible signaling protein

HOG Organism Gene ID Name Annotation
cHOG0096 nrc1 VNG0874 traB possible signaling protein
cHOG0096 hmu HMUK2748 Hmuk_2748 TraB family protein
cHOG0096 hma RRNAC0436 traB putative plasmid transfer protein
cHOG0096 hwa HQ2668A traB plasmid transfer protein
cHOG0096 hla HLAC0860 Hlac_860 TraB determinant protein
cHOG0096 hbo HBOR00330 Hbor_00330 uncharacterized PrgY-like protein, pheromone shutdown like protein
cHOG0096 hbo HBOR16750 Hbor_16750 uncharacterized PrgY-like protein, pheromone shutdown like protein
cHOG0096 hut HUTA0436 Huta_0436 TraB family protein
cHOG0096 hvo HVO_1554 HVO_1554 traB TraB family protein
cHOG0096 nph NP2702A hypothetical protein
cHOG0096 hhi 1197 traB putative plasmid transfer protein
MUSCLE (3.6) multiple sequence alignment


330|hp|hbo          ----------------------------------MSERTE---------NGTIRIVGTAH
2668|gene|hwa       ----------------------------------MSQEATD--------TGRVRVVGTAH
16750|hp|hbo        ----------------------------------MSKEATG--------EGRVRVVGTAH
860|gene|hla        MTETPGGSDGASPPPTASEPAPTASDSAPIDGEGSPASGAAGTPAAGDESGSVTVVGTAH
874|gene|nrc1       ----------------------------------MSEDAASADR-----EGSVRVVGTAH
10436|gene|hma      ----MILVAVSRRSPGPDKGKGNECVTRVMTEHAESAADEFPEPSG---AGRVDVVGTAH
1197|gene|hhi       ----------------------------MMTEHAESAADEFPDPSG---AGRVDVVGTAH
436|gene|hut        ----------------------------------MSDTVDPPEPSGAGGEGSVHLLGTAH
2702|hp|nph         ----------------------------------MSTDVE---------EGSVTVVGTAH
                                                       .              * : ::****

330|hp|hbo          VSADSVREVESVIRDEHPDVVAVELDEGRYRRLTGDT-DDPDPEALLESTTSVRLILHWV
2668|gene|hwa       VSAESAEKVQSVIETEQPDVVAVELDEGRYRQLRGDEPDDLAAADLLRGNTVFQFLAYWM
16750|hp|hbo        VSEDSVREVEDVVAEERPDVVAVELDEGRYRQMKGGAPDDIEPGDLLRGNTVFQFIAYWM
860|gene|hla        VSKQSVDEVEETIERERPDVVAVELDEGRYRQMNGESPDDLDASDLLRGNTVFQFLAYWM
874|gene|nrc1       VSSDSVEEVERVIDDEHPDTVAVELDEGRFRQMQGDAPDDLDATDLLKGSMAFQFLAYWL
10436|gene|hma      VSEHSVTEVESAIEESEPDIVAVELDEGRYRQIKGETPDDLDASDLLRGNTVFQFLAYWM
1197|gene|hhi       VSEHSVKEVESAIEESEPDIVAVELDEGRYRQIKGETPDDLDASDLLRGNTVFQFLAYWM
436|gene|hut        VSAESAERVERTIEDEQPDVVAVELDEGRYRQLKGESPDDIEASDLLEGNTVFQFLAYWM
2702|hp|nph         VSEASVEEVEAVIDEERPDVVAVELDEGRYRQLRGEAPEDLDAGDLLKGNTVYQFLAYWM
                    **  *.  *: .:  . ** *********:*.: *   :*  .  ** ..   .:: :*:

330|hp|hbo          LSYVQAQLGDQFDIEPGSELLKAVETADEIGTDIALVDRDIRVTVQRFWSQMTIREKLRL
2668|gene|hwa       LSYVQTRLGDRFDVQPGADMLAAIDAADATGTDIALVDRDINETMRRFWNRMTRIEKIQL
16750|hp|hbo        LSYVQAQLGEKFDVEPGADMLAAVETAEKFGIDVALVDRDINETMRRFWSQMSLIEKLKM
860|gene|hla        LSYVQTQLGDRFDIEPGADMRAAIDVAEGLGIDVALVDRDIQTTIQRFWARMSLTEKLRM
874|gene|nrc1       LSYAQRRLGEKFGIEPGADMQAAVDAANTAGADVALVDRDIQVTIQRFWARMSLPEKLRM
10436|gene|hma      LSYIQTRLGDRFDIEPGADMKAGIDTAERLGLGVALVDRDIQTTVQRFWARLTAVEKLKL
1197|gene|hhi       LSYIQTRLGDRFDIEPGADMKAGIDTAERLGLGVALVDRDIQTTVQRFWARLTAVEKLKL
436|gene|hut        LSYVQARLGDRFDVTPGADMMAGVETAEAAGIDVALVDRDIQTTVQRFWKRLTGLEKLKL
2702|hp|nph         LSYVQARLGDRFDIEPGADMKAAVDTAEAYGIDVALVDRDIQVTIQRFWARLSFFEKLKL
                    *** * .**:.*.: **:::  .::.*:  * .:*******. *:.*** .::  **:.:

330|hp|hbo          AGGLLLGFADTRTVGLVLGLFIGITLGPIVGLFGGNFGVTDPLLTRVAASGLLALAVGTV
2668|gene|hwa       IGGLAVGAGNGLGIGLAIGVIAGLFFGPLIALFGNTIGITSALLTRVAGGALLALATGSV
16750|hp|hbo        VGGLAFGLGDSRGVGIVIGLIIGLLVGPLVGLFGGSFGIGLPILSRITGGAVVLAAVAAV
860|gene|hla        VGGLAFGVTDSRVVGVLVGLFVGILAGPVIGLFGGSVGVTDALLTSVTGGVLATVAVAIA
874|gene|nrc1       GGELALGVTDSLTLGLTVGGLIGAFVGVIAELLGGLY-----------------------
10436|gene|hma      VGSLAAEMGPPLTVGLTIGAVFGGLFAVVAGAFGGPF-----------------------
1197|gene|hhi       VGSLAAEMGPPLTVGLTIGAVFGGLFAVVAGAFGGPF-----------------------
436|gene|hut        FGGMLAGIGGPWAAAWTVGLMVGLFVGILGSALGVSV-----------------------
2702|hp|nph         VGSLAVGFGTPVEIGMGVGIGIALVVSILAGAVAGPF-----------------------
                     * :          .  :*   .   . :   ..                          

330|hp|hbo          LYTVGKAIFDHRTVVTASLTGGVSIGLLAGAGLGIADGTVTAYLPPMLLHGIGSLLIGLS
2668|gene|hwa       IWIGAATILSAEDRLLAAVGGGIAVGGIAGFGLGI-AEPITTQLGPLTVRVIGSVTLGLA
16750|hp|hbo        LWVVSAPFLDTENRILVALGGGTAAGIIGGFGLGL-AAPFIASLSSFAVRTVGSLTLGVG
860|gene|hla        VDQVGKVALSPDGRLYAAAALGVAAGIIAAAVGAL-DGIVATYLGGFAVTAIGSLGLGIS
874|gene|nrc1       ------------------VLPSVPPG-LGVLAGVV--GVIAAITEVGLFAIAGGAVFGIA
10436|gene|hma      ---------------------IVPSGALSVLPGGL-GGTVEGLLDTLLLICVAAAGIGIP
1197|gene|hhi       ---------------------IVPSGALSVLPGGL-GGTAEGLLDTLLLICVVAAGIGIP
436|gene|hut        ---------------------------LGAVGLSV---PFASAIDVLLLAGGVGTVIALP
2702|hp|nph         ---------------------VVPAG-LGP-------GILVGAADTLLVALGLGLVLGLA
                                               :.                   .    .  :.: 

330|hp|hbo          AGLVVGVLGGLVAERLGLSG--ID-IDEADEFVAADLTDTDVVQTMLTEFRELCPNGARA
2668|gene|hwa       AGIIAGTLLGELTDIFRTQQ--PE--ENIEEFDMAEMTDTDVVSAMMAEFRQFSPGGAEA
16750|hp|hbo        VGLLLAGLAATLATAFGMGP--DDDVEEMEELDIDSMTDTDVVSAMMEEFREFSPGGAQA
860|gene|hla        LGLTLGVVASLAMTVVGRGTSEPE-HGGIEELGMEDLTDTDVVTMMMEEFRQFSPGGAEA
874|gene|nrc1       FTAVLAWTA-------------PDTETDVAEFSMDELTDADVVSAMMAEFRRFSPGGAQA
10436|gene|hma      IAALLVRFRG---------------EADVEEFDMEKLTDTDVVSAMMEEFRQFSPGGAEA
1197|gene|hhi       IAALLVRFRG---------------EADVEEFDMEKLTDTDVVSAMMEEFRQFSPGGAEA
436|gene|hut        LLAAFSGFE----------------DEDVEEFDIEQLTDTDVVSAMMEEFRRFSPGGAEA
2702|hp|nph         ITALLGRLA-------------PE-DDELQEFDVDRMTDTDVVSAMMEEFRRFSPGGAEA
                                                  *:    :**:***  *: *** :.*.** *

330|hp|hbo          LIDERDAYIAYQLVALRDSGLDVVAVLGAGHRGGVEQYLSNPATLPPHGTLVGTSRGPSV
2668|gene|hwa       LIDERDAYIANRLVELRNQGQTVVAVVGAGHREGIERYLTHPGTLPPQESLTGTQSG-RI
16750|hp|hbo        LIDERDAYIAHRLVALRQSGHHVVAVVGAGHREGIERYLKYPERLPPMDSLTGTPSS-GL
860|gene|hla        LIDERDAFIAHRLVALREAGHNVVAVVGAGHRAGIEGYLADPASLPPMEDLVGKERGRRL
874|gene|nrc1       LIDERDAFIAHNLLALRAQGKDVVAVVGAGHRDGIMNYLENPDSLPPMESLTGKETGGSW
10436|gene|hma      LIDERDAFIAHRLIALREAGYHVLAVVGAGHREGIQGYLDNPETLPPMESLTGTEGGRRV
1197|gene|hhi       LIDERDAFIAHRLIALREAGYHVLAVVGAGHREGIQGYLDDPETLPPMESLTGTEGGRRF
436|gene|hut        LIDERDAYIAHQLVGLREAGADVVAVVGAGHRAGIQGYLDNPETLPPMDSLTGTISGRRF
2702|hp|nph         LIDERDAYIAHNLVSLRDQGHDVVAVVGAGHRKGIEKYLETPSLLPPMEDLTGKASGSRF
                    *******:** .*: **  *  *:**:***** *:  **  *  ***   *.*.  .   

330|hp|hbo          PVKKIAGALISVAFVASFVLLAMA------GVDDAYLLEVFVAWFLVNGVFAAGMAYLAG
2668|gene|hwa       PWSKLVGGSVSAIVIGFFVLLALS------SAGNQTLLRLFGAWFLINGIFAAGLAKAAG
16750|hp|hbo        PWAKIVGTGISAAVVVFFGLLTLS------TAGNDTLIRLFGAWFLINGAFAAGLAKALG
860|gene|hla        PWKKAIGYAITVSFVGFFVLLALA------GVENAFLFRLFGAWFLINGAFAFAFAKLAG
874|gene|nrc1       -LLKGVGLAFTVGFLVFFALLVMA------GVGNDVLLQVFGGWFLFNGVFSLTTAKLAG
10436|gene|hma      SLYKLVGYGFGVVFLVFFGLLILG------GASQAVLLQLFVALVAVNAVLAGGLAKVAG
1197|gene|hhi       SLYKLVGYGFGVVFLVFFGLLILG------GASQAVLLELFVALVAVNAVLAGGLAKVAG
436|gene|hut        SLYKILGYLFTLGFGAFFVLLLLG------GANQGWLLRLFAAWFLVNGIIAAALAKVAG
2702|hp|nph         SLYKLFGYLFTLGFLAFFVLLAIATYTGVEGASSELLFRLFAAWFLVNGALAAGLAKFAG
                       *  *  .   .   * ** :.       . .  *: :* . . .*. ::   *   *

330|hp|hbo          ACWTAALTGGAVAWLTSVNPVLAPGWFVGYVELRRTPVDVADFDALNELLSGDDG-LSDI
2668|gene|hwa       AHWSSSLVGGAIAWLTSINPFLAPGWFTGYVELQHDPVNVSDISTLNELLSDEERPIGAL
16750|hp|hbo        ARWPSALVGGAVAWMTSINPFLAPGWFTGYMELQYDPVNISDISRLNELLADEEAPLGEL
860|gene|hla        ARWTSAGVGGAVAWMTSINPVLAPGWFTGYVELRHLTVNVGDIGRLNELLSDETQSPSEL
874|gene|nrc1       AHWTSAGVGGAVAWLTSVNPLLAPGWFAGYIELRYLSVHVTDIETLNTLLDDETRPVREI
10436|gene|hma      AHWSSAAAAGAFGWLTSLFPLLAAGWFAGYVELRYISVNISDIATLNEILNDQESPVMDL
1197|gene|hhi       AHWSSAAAAGAFGWLTSLFPLLAAGWFAGYVELRYISVNISDIATLNEILNDQESPVMDL
436|gene|hut        AHWSSAGVGGAVAWLTSVNPLLAPGWFAGYVELRYLDVNVSDISRLNELLDDQELPIPEL
2702|hp|nph         AHWRSAGVGGAVAWLTSVNPLLAPGWFAGYVELRYLNVNVGDISTLNELMSDEETPLRQL
                    * * :: ..**..*:**: *.**.***.**:**.   * : *:  ** :: .:      :

330|hp|hbo          RSKVASVPLLRLLAIVALTNVGSIVASVLFVAYLLPLF--AGDLGGVDAVSRLLFEGLRN
2668|gene|hwa       ITELLEVPLFRLIIVVAATNIGSIVASTIFVAYLLPLF--ALDLGGVSGVVTLLIEGARN
16750|hp|hbo        VSDLFDVPLFRLIMVVAATNIGSIVASALFIGYVLPLF--ALDLGGPQGIINLMFEGAQN
860|gene|hla        VSAMLDVPLFKLIVVVAMTNIGSIVASFLFAVYVIPAM--FGDVGGVDEVGRLMVEGART
874|gene|nrc1       VSEMLDVPLFRLIAVVAMTNVGSIVASVLFPLVVLPAI--GGPFDSLHAVSDAMVQGAEN
10436|gene|hma      VSRMRAVPLFRLILVVALTNVGSAIASYVVFPVLIPYI--SSDIGGMQGVSRLLWQGVRE
1197|gene|hhi       VSQMRGVPLFRLILVVALTNVGSAIASYVVFPVLIPYI--SSDIGGMQGVSRLLWQGVNE
436|gene|hut        VARMREVPLFRLILIVALTNIGSFIASMLFASTILPLM--SNEVGGVGEVAELLIMGARN
2702|hp|nph         WSDLTDVPLFRLIMIVALTNVGSFIGSIVFATVFLPYLFAGSGVEGASGVARLMVEAARN
                     : :  ***:.*: :** **:** :.* :.   .:* :     . .   :   :  .   

330|hp|hbo          GADILWRSLTSA-
2668|gene|hwa       GWQIIWTNIT---
16750|hp|hbo        GWNILISLL----
860|gene|hla        GAELIRSAVTGGA
874|gene|nrc1       SARALWGLL----
10436|gene|hma      GTQILVGVL----
1197|gene|hhi       GTQILLGVL----
436|gene|hut        GAEMLWNLVG---
2702|hp|nph         SVDIIFGSFQ---
                    .   :   .