HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0095COG0115KOG0975arCOG02297Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyasebranched-chain amino-acid aminotransferase

HOG Organism Gene ID Name Annotation
cHOG0095 nrc1 VNG2122 ilvE2 branched-chain amino-acid aminotransferase
cHOG0095 hmu HMUK1109 Hmuk_1109 branched-chain amino acid aminotransferase( EC:2.6.1.42 )
cHOG0095 hma RRNAC3071 ilvE1 branched-chain amino acid aminotransferase
cHOG0095 hwa HQ3234A ilvE branched-chain amino acid aminotransferase
cHOG0095 hla HLAC0353 Hlac_353 branched-chain amino acid aminotransferase
cHOG0095 hbo HBOR28430 Hbor_28430 branched chain amino acid aminotransferase apoenzyme( EC:2.6.1.42 )
cHOG0095 hut HUTA2934 Huta_2934 branched-chain amino acid aminotransferase
cHOG0095 hut HUTA2019 Huta_2019 branched-chain amino acid aminotransferase
cHOG0095 hvo HVO_0329 HVO_0329 ilvE branched-chain amino acid aminotransferase
cHOG0095 nph NP5036A ilvE_1 branched-chain amino acid aminotransferase
cHOG0095 hhi 326 ilvE1 branched-chain amino acid aminotransferase
MUSCLE (3.6) multiple sequence alignment


2934|gene|hut       -------------------------------------------------MAEITFTPSGF
5036|gene|nph       ------------------------------------------------------------
2019|gene|hut       ------------------------------------------------------------
13071|gene|hma      MCGADGQIPLKRLCSPGQCSVLAVRDNATLTRGGIVNTLNHGNQWGRYDTRRDSRRHHPR
326|gene|hhi        ------------------------------------------------------------
353|gene|hla        ------------------------------------------------------------
2122|gene|nrc1      ------------------------------------------------------------
3234|gene|hwa       ------------------------------------------------------------
28430|gene|hbo      ------------------------------------------------------------
                                                                                

2934|gene|hut       GQGMSDGTMPTGFEAKREASDTLDTIWMDGEFIPWEDATIHVLSHALHYGTSVFEGVRCY
5036|gene|nph       -------------MAFEEM--DVDTIWMDGEFVDWDEAQTHVLTHSLHYGTGVFEGARCY
2019|gene|hut       ------------------M--DVGTIWMDGEFVDWEDAQVHVLTHGLHYGTGVFEGVRSY
13071|gene|hma      APRLSAHRRGRAMSDRPEMFEGTDRIWMDGEFVDFEDAQTHVLTHALHYGTGVFEGVRCY
326|gene|hhi        ------------MSDRPEMFEGTDRIWMDGEFVDFEDAQTHVLTHALHYGTGVFEGVRCY
353|gene|hla        ------------------M--DVDTIWKNGEYLDWEDATTHVLTHALHYGSGVFEGVRCY
2122|gene|nrc1      ------------MPSFSEM--DVDTIWMDGEFVDWEDAQVHVLTHALHYGSGIFEGVRVY
3234|gene|hwa       -------------MEFDEM--DVETIWQDGSFVDWDDATVHVLTHGLHYGTGVFEGVRCY
28430|gene|hbo      -------------MGFDEM--DVDTIWMDGEFVDWDDAQVHVLTHGLHYGTGVFEGVRCY
                                             ** :*.:: :::*  ***:*.****:.:***.* *

2934|gene|hut       ETADGPALFRWDAHLDRLYNSAAMYDLDIGFDREELTTATLELLARQDLGGCYVRPIAFY
5036|gene|nph       DTEDGPALFRWEEHLDRLFESAKVLDHDIDHTHEEITDATLRLIREQGLESCYIRPLVYY
2019|gene|hut       DTDNGAAIFRWEDHLDRLYQSAKPYGMEIPFNREELTEATLELIEREDLPSCYIRPIAFY
13071|gene|hma      DTEQGPAIFRWEEHLDRLYKSAKPYDLDIEFSKDELTEATTELIETEGFESCYIRPIVYY
326|gene|hhi        DTEQGPAVFRWEEHLDRLYKSAKPYDLDIEFSKDELTEATTELIETEGFESCYIRPIVYY
353|gene|hla        DTEQGPAIFRWEEHLDRLFDSAKMYDMEIEYSREEITEATLELLDRQDLDSAYIRPLAYF
2122|gene|nrc1      DTDNGPAIFRWDDHLQRFYESAKPYDLDIEFTPDELTDATVELIQRQDLGSCYIRPLAYY
3234|gene|hwa       DTQNGPAIFRWDEHLERLYQSAQPYDMEIPYTREELTTATLELLRREKLESCYIRPVAFY
28430|gene|hbo      DTEKGPAIFRWEEHLERLYDSTKPYDMEISFEPEELTEATLELLRRQDLNEAYIRPIAFY
                    :* .*.*:***: **:*::.*:   . :* .  :*:* **  *:  : :  .*:**:.::

2934|gene|hut       GYDRLGVSPTTPTKLPERVAIAAWPWESYLGESALEDGIDAGVSSWRKYGHDQIPPTAKT
5036|gene|nph       GYNSLGVS---PEDCPTKTMVACWPWGAYLGEDAIENGVDVMVSTWRKHASSQIPTNVKA
2019|gene|hut       GYDMLGLN---PGDAPVKVAIAVWPWGAYLGEEALEEGVDVAISSWRKFASSQIPTNAKT
13071|gene|hma      GFDSLGVS---PKDCPTKTTIAAWPWGAYLGEEALEEGVDVMVSSWRKHASSQIPTNIKT
326|gene|hhi        GFDSLGVS---PKDCPTKTTIAAWPWGAYLGEEALEEGVDVMVSSWRKHASSQIPTNIKT
353|gene|hla        GYDSLGVS---PKDCPTDLVLAAWPWGAYLGEEALEEGVDVMVSSWRKHASSQVPTNVKT
2122|gene|nrc1      GYESLGVS---PGDCPTDVAIAAWPWGAYLGDDALENGVDVMVSTWRKHASSQIPTNAKT
3234|gene|hwa       GYGSLGVS---PGDNPVDVAIAAWPWGAYLGEEALTKGVEVMISSWRKHASSQIPTNAKT
28430|gene|hbo      GYESLGVS---PGDCPTNVTIAAWPWGAYLGEDALENGIEVMVSSWRKHASSQVPTNAKT
                    *:  **:.   * . *    :* *** :***:.*: .*::. :*:***.. .*:*.. *:

2934|gene|hut       TGAYVNGVLATDEAARNGYDEAIVLNSEGNVAEGPGENLFLVDDGEIYTPGLAEDALDGI
5036|gene|nph       TGPYINSMLAGEEARRNGYVEAIVLNKEGKVAEGPGENIFMVNDGEIYTTGLSESILDGI
2019|gene|hut       TGPYVNSVLASLEAEENGYTEAILLNKEGQVAEGPGENLFLVRDGEIHTPGLAESNLDGI
13071|gene|hma      TGLYVNSMLAGEEARRNGYTEAIVLNKEGNVAEGPGENIFMVRDGEIYTPGLAESILEGI
326|gene|hhi        TGLYVNSMLAGEEARRNGYTEAIVLNKEGNVAEGPGENIFMVRDGEIYTPGLAESILEGI
353|gene|hla        TGLYVNSMLAGEEARRNGYVEAIVLNKEGNVAEGPGENIFMVNDGEIYTTGPAQSILEGI
2122|gene|nrc1      TGLYVNSMLAGEEARRNGFTEAIVLNKEGNVAEGPGENIFLVRDGELFTPGLSESILDGI
3234|gene|hwa       TGLYVNSLLAGEEARRNGYTEAIVLNKEGNVAEGPGENIFMIRDGEIYTPGLSESILDGI
28430|gene|hbo      TGLYVNSLLAGEEARRNGYREAIVLNKEGNVAEGPGENIFLVRDGELYTPGLSESILDGI
                    ** *:*.:**  **  **: ***:**.**:********:*:: ***:.*.* ::. *:**

2934|gene|hut       TRQSVIELAREAGYTVHDDARIGRGELYTADELFFTGTAAEVTPIRSVDDRAIGAGSKGP
5036|gene|nph       TRDTVIELARDLGYTVHDEAAIGRGQLYTADELFFTGTAAEVTPIRSVDDTEIGNGGRGP
2019|gene|hut       TRQTVIDLAEERGYTVHADATISRGELYTADELFFSGTAAEVTPIRSVDDTEIGLGTKGP
13071|gene|hma      TRNTAITLAEEMGYTVHEEATISRGELYTADELFFTGTAAEVTPIRSVDDNEIGEGTKGP
326|gene|hhi        TRNTAITLAEEMGYTVHEEATISRGELYTADELFFTGTAAEVTPIRSVDDNEIGEGTKGP
353|gene|hla        TRDTVIELAKERGYTVHDEAVISRGQLYTADELFFTGSAVEVTPIRSVDDTEIGSGTCGP
2122|gene|nrc1      TRDTVITLAEERGYTVHDDVSISRGELHTADELFFTGSAAEVTPIKQVDNVEIGSGTRGP
3234|gene|hwa       TRNTVIELARDRGYTVHDRATISRGELNTADELFFTGTAAEVTPIRKVDNVEIGDGSRGP
28430|gene|hbo      TRNTLITLAEERGYEVHENTSISRGELNTADELFFTGSAAEVTPIRQVDNVEIGNGSRGP
                    **:: * ** : ** **  . *.**:* *******:*:*.*****..**:  ** *  **

2934|gene|hut       VTDDLQTRFFDLVSGPVDTHEAWFTRVH--
5036|gene|nph       VTEEIQQRFFDLVDGKLDGYDEWFLPVETE
2019|gene|hut       VTDEIQQAFFDVVE--SGEREEWFTYV---
13071|gene|hma      VTDELQSAFFDVIE--SGDREEWFHYV---
326|gene|hhi        VTDELQSAFFDVIE--SGDREEWFHYV---
353|gene|hla        VTEELQSAFFDLVERRTDAHDDWFTYL---
2122|gene|nrc1      VTEELQTAFFDLVE--AGDREEWFHYV---
3234|gene|hwa       VTEELQQAFFDLIDRETSAHEEWFTYL---
28430|gene|hbo      VTEELQQAFFDLVERRTDDHDEWFTYL---
                    **:::*  ***::.   .  : **  :