HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0094COG0640arCOG02943transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0094 nrc1 VNG0703 arlR7 transcriptional regulator
cHOG0094 nrc1 VNG2614 arlR16 transcriptional regulator
cHOG0094 hmu HMUK0311 Hmuk_0311 transcriptional regulator, ArsR family
cHOG0094 hma RRNAC2101 hypothetical protein
cHOG0094 hwa HQ1370A ArsR family transcriptional regulator
cHOG0094 hla HLAC0395 Hlac_395 ArsR family transcriptional regulator
cHOG0094 hbo HBOR27710 Hbor_27710 transcriptional regulator, ArsR family
cHOG0094 hut HUTA0335 Huta_0335 ArsR family transcriptional regulator
cHOG0094 hvo HVO_0422 HVO_0422 conserved hypothetical protein
cHOG0094 nph NP0674A transcription regulator
cHOG0094 hhi 2590 arsR7 ArsR family transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


703|hp|nrc1         -MSSTDETVQELPPSAKLVLKVLEYNGGLTQKQIVENSRLSQRTVRDALDRLQDADVVEK
2614|hp|nrc1        MMAADDSVLEDLPPSAKLVFKVLEYDGPLTQKRIVEETMLSARTVRYALERLEDRDAVDE
1370|gene|hwa       MAKGEEERLDDLPPSAKLVFKVLEYSGPLTQKGIVEESMLSARTVRYALERLEDIDIVDE
395|gene|hla        MEGTQTEGLDDLPPSAKLVFKVLEYNGPLTQKGIVQESMLSARTVRYALERLEGIDVVDE
27710|gene|hbo      MAEAEQESLDDLPPSAKLVFKVLEYNGPLTQKGIVQESMLSARTVRYALERLEGIGVVDE
674|gene|nph        MADSDGEALADLPPSAKLVYKVLEYNGAMTQKDIVEESMLSARTVRYALERLEDIDIVSE
335|gene|hut        MAEPDEEDITDLPPSAKLVFKVLEYKGPLTQKGIVEESMLSARTVRYALERLEEVDVVSE
12101|hp|hma        MTDSDGEAIADLPPSAKLVYKVLEYDGPLTQKGIVEESMLSARTVRYALERLDEVGVIEE
2590|gene|hhi       MTDSDGEAIADLPPSAKLVYKVLEYDGPLTQKGIVEESMLSARTVRYALERLDEVGVIEE
                          . : :******** *****.* :*** **::: ** **** **:**:  . :.:

703|hp|nrc1         DIYIPDARQNLYRLKL-GDEETAEDDA------------------DKPVEAL-LD
2614|hp|nrc1        DIYFADARQSLYDLTP----DAAPEDA------------------DADAEAA---
1370|gene|hwa       DVYFADARQNLYQLTEAVPKAATSTDGGESGSTSSLSDSESDSEPDSEVEPRHAE
395|gene|hla        DVYFADARQKLYKLTE----PAQEFTG------------------DENEASCTAD
27710|gene|hbo      DVYFADARQNLYQLTEAAPKHPSEGDA------------------DEAEACC-AE
674|gene|nph        DVYFADARQNLYELTD---EAEAVTDG------------------AADPAAC-DD
335|gene|hut        DVYFADARQNLYELTT------GDDAT------------------EKQDQAV-SD
12101|hp|hma        DVYFADARQNLYEIIE----QPAEADA-----------------------AV-SD
2590|gene|hhi       DVYFADARQNLYEIID----QPAEADA-----------------------AV-SD
                    *:*:.****.** :