HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0934COG1534arCOG01346Predicted RNA-binding protein containing KH domain possibly ribosomal proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0934 nrc1 VNG0601 vng601 no entry
cHOG0934 hmu HMUK1999 Hmuk_1999 protein of unknown function UPF0044
cHOG0934 hma RRNAC1348 hypothetical protein
cHOG0934 hwa HQ2502A hypothetical protein
cHOG0934 hla HLAC1188 Hlac_1188 protein of unknown function UPF0044
cHOG0934 hbo HBOR20740 Hbor_20740 predicted RNA-binding protein containing KH domain, possibly ribosomal protein
cHOG0934 hut HUTA0090 Huta_0090 protein of unknown function UPF0044
cHOG0934 hvo HVO_1166 HVO_1166 Predicted RNA-binding protein containing KH domain possibly
cHOG0934 nph NP4478A hypothetical protein
cHOG0934 hhi 1937 HAH_1937 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


90|hp|hut          MSDVTPENAMHDLDVTVWVGKKGLDAVVDELGDQLHERGLVKVKFLRAARSEGEPATLAA
11348|hp|hma       MSDSSRQSRIHDLDATLRVGKHGIESVADELDDQLENTDLVKVKFLRSSRGGTTAEELAD
1937|hp|hhi        MSDSSRQSRIHDLDATLRVGKHGIESVADELDDQLENTDLVKVKFLRSSRGGTTAEELAD
601|hp|nrc1        MSD-DLATKAHEADVTVWVGKAGIESVVEELADQLDDRDVVKVKFLRAARGGDDTAGLAA
4478|hp|nph        MNDRDLQARAHDIDATLRVGKAGIDAVVDELSDQLADRDLVKVKFLRAARGGTTTEELAA
1188|gene|hla      MSDQQLRKEAHDLDVTVWVGKHGIDSVIDETADQLADAKLVKVKFLRAARGGTTTDELAA
2502|hp|hwa        MDTQALRKQAHDLDITVWVGKSGIDPVEPELDNQLKDTDLVKVKFLRAAQGGTTVAELAD
20740|hp|hbo       MGKQDLRKEAHDIDVTVWVGKSGISAVEEELSDQLADRDLVKIKFLRSARAGTTVEELTE
                   *.        *: * *:.*** *:..*  *  :** :  :**:****::..      *: 

90|hp|hut          ELADRTNATVVDTRGHTTVLKR-
11348|hp|hma       DLAEMVNASVIQVRGHTAVFEK-
1937|hp|hhi        DLAEMVNAEVIQVRGHTAVFEK-
601|hp|nrc1        DLADRVGATVVDVRGNTAVYH--
4478|hp|nph        DLADRVNADLVETRGHTAVFHR-
1188|gene|hla      ELADAVNADLIETRGNTAVLH--
2502|hp|hwa        DLANRVNAHVIETRGNTGVLYRR
20740|hp|hbo       ELADRVNAEVIETRGNTGVVHR-
                   :**: ..* :::.**:* *