HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0933COG3361arCOG04579Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0933 nrc1 VNG1746 vng1746 no entry
cHOG0933 hmu HMUK2704 Hmuk_2704 conserved hypothetical protein
cHOG0933 hma RRNAC0485 yqjF hypothetical protein
cHOG0933 hwa HQ1500A hypothetical protein
cHOG0933 hla HLAC1200 Hlac_1200 hypothetical protein
cHOG0933 hbo HBOR21740 Hbor_21740 uncharacterized conserved protein
cHOG0933 hut HUTA0115 Huta_0115 conserved hypothetical protein
cHOG0933 hvo HVO_0959 HVO_0959 conserved protein YqjF
cHOG0933 nph NP2788A hypothetical protein
cHOG0933 hhi 1153 HAH_1153 hypothetical protein
cHOG0933 hhi 1152 HAH_1152 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1152|hp|hhi        ---------------------MVALRPLQVTLDDVCFCHWPVPETAVQATVPDWLTVETA
115|chp|hut        -----MWDRLQKSSRSGRELLARLSPTLHMGWRQVLFANWPVDPSVVRPHVPDGLAVDTH
1500|hp|hwa        MVIMSLADRVRDRVSAVGQGFDGVTDLLTMQWRDVLFAHWRVDPEVVEKQLPSEVTVATH
1746|chp|nrc1      ------------------------MDVLSMRWADVLVASWPVDPEVVADRLPDGVDVDTH
21740|hp|hbo       --------------MRSGDAAFGDEALVQMRWRDALFAHWETDPETVAGRLPPGVEVATF
1200|hp|hla        ---------------------MLERRVLEMTWRDGLFCHWPVDPAVVSGTLPDRLSVATH
2788|hp|nph        -----------------------MRNLLEMTWRDLLFAHWTVPPETVAETLPDGLAVDTF
10485|hp|hma       ------------------------MDLLTMTWRDVGFMHWPVEPDSVQTTLPDGLDVDTY
1153|hp|hhi        ------------------------MDLLTMTWRDVGFMHWPVEPDIVQSTLPDGLTVDTY
                                              : :   :  .  * .    *   :*  : * * 

1152|hp|hhi        DGDAWVSAVGATVDRVETFGIE--VAGPSELLTVRTYVR---------------------
115|chp|hut        AGDAWLSVVPYTNVDVRPTWIPAGWGVALPELNLRTYVT---------------------
1500|hp|hwa        NGDAFLGIVPFEMADIRPRGSP--IGRSFPELNLRTYVR---------------------
1746|chp|nrc1      DGDAYLSVVPFVMENIRPRGLPSGVGRTFGELNLRTYVT---------------------
21740|hp|hbo       DGHAWLGVVAFVMEDIRPCGVP--FGLSFPELNLRTYVTRSVDDAERSEDDTERSGDGAE
1200|hp|hla        GGDAYLSVVAFVMDDIRPRGAP--VGLSFPELNLRTYVE---------------------
2788|hp|nph        DGDAYLGVVPFVMSDISPRGVP--FGLEFGELNLRTYVT---------------------
10485|hp|hma       DGQAWLSVVPFQMADIRPRGSP--IGRSFGELNLRTYVV---------------------
1153|hp|hhi        DGQAWLSVVPFQMADIRPRGSP--IGRSFGELNLRTYVV---------------------
                    * *::. *      : .       .     *.:****                      

1152|hp|hhi        ---------GPTGQRGVCVLALFGDDRRTTTAVSELFRITVGDATPRTL--------STA
115|chp|hut        ----------HDGHDGVYFFSLDADGLLGVLGARLFHHLPYFYASISID---------TD
1500|hp|hwa        --------QPGSQTRGVYFFNLDADDTIGVEIARRGFKLPYYHAKMELT---RNAASEGK
1746|chp|nrc1      ----------VDGRPGIYFFNLDATDALGVRVARRLFGLPYYTADMRIE--------RRA
21740|hp|hbo       ASSTGHRTQSGDSARAVYFFNLDADDRLGVALARLLYSLPYYRADMRVR--------SGA
1200|hp|hla        ----------GPDGPGVYFYNLDADDRIGVELARRLFALPYYRAEMDVSHPATAKRSESA
2788|hp|nph        ----------VDGRPGVYFYNLDADDRIGVAIARALFQLPYYRAAMDIE-----TRGEGT
10485|hp|hma       ----------ADGTPGVYFYNLDADDRLSVTLARQLFQLSYYQASMQVR---------TD
1153|hp|hhi        ----------ADGTPGVYFYNLDADDRLSVTLARRLFQLSYYRASMQVR---------TD
                                  .: .  * . .   .  .   . :.   *                

1152|hp|hhi        DR------RRVLDAGERRLFECRYTAGGEPVAIPP--DSLASFLVDRQRYFTTGRFGTHL
115|chp|hut        GDRVRFESERRHPGARPARFAGTYHPTGDQLAADA--GSRAAFLTERYRYYTQVPSGTLR
1500|hp|hwa        NKTIHITSKRTRDTVAPARFEATYGPVDGANYVQPTTGSLTAFLTENYQFYT--DGRTLY
1746|chp|nrc1      GGALAVRSTRTHAGQPSLAFDATYEQAGACSRATP--GSLTAFLLERYRFFVASEDGTVY
21740|hp|hbo       DESIEFASQRTHWNAPPAHFDATYEPVGDDFTPEP--GTLEHFFVENYRFYT--VGRRLY
1200|hp|hla        GGPVRFTSRRAHPGVPHARFDATYEPTGEALAAEP--GSLDAFLVENYRFYA--EGNRLY
2788|hp|nph        DREVRFRSRRTSD-APDARFDARYGPDSDFSTPDP--GSLPAFLTERYRFYTTDRGGTVY
10485|hp|hma       GDSVEFRSRRTSSRAPPADFHATYEPTEPPSTPEP--GSVESFLVERYRFYAASDDGTVY
1153|hp|hhi        GDSVEFRSRRTSSRAPPADFHATYEPTEPPSTPEL--GSVESFLVERYRFYAASDDGTVY
                   .        *         *   *             .:   *: :. .::.        

1152|hp|hhi        VGSVGHDPWRLDRVDATVTGSVLPLVDISDREAE-PLVHHSPGLRVSIAPPVPP------
115|chp|hut        YARVDHEPWQLYEANVDLGENTLFEANGFAHPETDPIHYYSPGVRTIATRNRPI------
1500|hp|hwa        RGTIRHSPWKIAEGHITIKENTLFTANGFEPPSDGPIVHYASDIDVTAGWIQSIGNSSEE
1746|chp|nrc1      QGAVDHDPWQLADATLDVRRNDLFTANGFEQPAGSPHIAYSPGVDVTAGLPTVV------
21740|hp|hbo       YGDISHPPWPLYEANAEIRSNTLFAANGFETPTDEPVVHYSPGIEVTAGRIHRA------
1200|hp|hla        RGEITHEPWTLRAATVDLRANTLFEANGFDRPDGDPIVRYAEPIDVSADRIRSVC-----
2788|hp|nph        YGDIDHEPWSLAPAWADIETNTLFAANGFDRPGGNPLLYFAAPIAVTADRIRRFAGPE--
10485|hp|hma       YADIDHEPWPLQRGQADIRTNGLFAASGFDRPDGDPLVHYCAEIPVTAGRLHRLDGVAQY
1153|hp|hhi        YADIDHEPWPLQAGRADIRTNGLFAASGFDRPDGEPLVHYCAEIPVTAGRLHRLDGVSQY
                    . : * ** :      :  . *  ..        *   ..  : .              

1152|hp|hhi        --
115|chp|hut        --
1500|hp|hwa        --
1746|chp|nrc1      --
21740|hp|hbo       --
1200|hp|hla        --
2788|hp|nph        --
10485|hp|hma       TD
1153|hp|hhi        TD