HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0932COG0526KOG3414 KOG0190 KOG0191 KOG0907 KOG0910 KOG1672arCOG04633Thiol-disulfide isomerase and thioredoxinshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0932 nrc1 VNG1302 vng1302 no entry
cHOG0932 hmu HMUK2311 Hmuk_2311 conserved hypothetical protein
cHOG0932 hma RRNAC1112 hypothetical protein
cHOG0932 hwa HQ2557A trxA thioredoxin
cHOG0932 hla HLAC1359 Hlac_1359 hypothetical protein
cHOG0932 hbo HBOR15610 Hbor_15610 hypothetical protein
cHOG0932 hut HUTA0508 Huta_0508 Thioredoxin domain
cHOG0932 hvo HVO_1655 HVO_1655 conserved hypothetical protein
cHOG0932 nph NP3114A trxA_5 thioredoxin
cHOG0932 hhi 1719 HAH_1719 thioredoxin
MUSCLE (3.6) multiple sequence alignment


1359|hp|hla        --------------------------------------------MTLETLDPDAADATEF
2557|gene|hwa      -------------------------------------MVDANVGRTLETMKPNPVWDANS
1302|hp|nrc1       -------------------------------------------------MEPNPAWDAES
508|gene|hut       --------------------------------------------MILETMEPNPVWNADA
11112|hp|hma       ------------------------------------------MSQTLETMEPNPVWVEDA
1719|gene|hhi      ------------------------------------------MSQTLETMEPNPVWVEDA
3114|gene|nph      --------------------------------------------MELETMRPNPAWDADA
15610|hp|hbo       MADGGKRRRYVASAVTEHRAANHSDTARFTSARSLETTMTEAEAGTLDTMQPNPAWDADS
                                                                    : *:..   : 

1359|hp|hla        DPAVLDALAA--DDYRFKVWGGDWCGDCQRQLPAFGAALAAAGVPDDRIEDFPVTKGPNG
2557|gene|hwa      WSDTVAAFSD--DTLIIRVWGGDWCDDCRRQLPDFAAAINAADIPNKRVHEYSVEKNADG
1302|hp|nrc1       YPAVIEAFESLPADATVHVWGGDWCGDCRSQLPDFAAALAASGVEP---AVHPVSRGDDG
508|gene|hut       HADTVETLGDF-ADATFKIWGADWCGDCRSQLPDFAAALDAAEIPDDHVEHYPVDRD---
11112|hp|hma       YADTVDVLTRYADEFEYKIWGGDWCKDCRAQLPDFGAALKAAGVPEGQVHHYPVEKEDDG
1719|gene|hhi      YSDTVDVLTHYADEFEYKIWGGDWCKDCRAQLPDFGAALKAAHIPDAQIHHYPVEKEDDD
3114|gene|nph      YAETVATFESLADDIVVKVWGGDWCKDCRSQLPDFGAALEAAGVDD--IEHYPVEKADDG
15610|hp|hbo       YEDTVETLSE--DGLVFKVWGGDWCKDCRNQLPDFAAALDAAEVPDERVEHYPVEKEDDG
                      .: .:         .:**.*** **. *** *.**: *: :       ..* .    

1359|hp|hla        -KEGEGVDEYEIELIPTVVVETAD-GEEVARFVEEADVSIAEYLAGELAGIEVNA
2557|gene|hwa      EKYGPSVKEYGINRIPTVVIE-RE-DEEVARFVETESVPIAVFLAEQLTE-----
1302|hp|nrc1       -KTGPRVDEYGIDRIPTVVVEGAD-GTEHARFEERDSLPPERYLADALSD-----
508|gene|hut       -KQGDGVDAYGIEYIPTVVVE-RD-GEELARFVEAEREPIAVHLATQLESAESTA
11112|hp|hma       SKTGPEVEAYDIELIPTVVVE-HD-GEEIARFVEEEPVPIAVYLADKIENAMA--
1719|gene|hhi      SKTGPHVEEYDIELIPTVVVE-HD-GEEIARFVEEEPVPIAVSLADQIEDAMA--
3114|gene|nph      SKHGPKVDEYDIEYIPTVVVEDADSGTELARFIEEEPEPIAVYLAEQLSE-----
15610|hp|hbo       SKTGPLVEEYDIEYIPTVVVE-RD-GEEVARFVEDARVPIAVYLANELAE-----
                    * *  *. * *: *****:*  : . * *** *    .    **  :