HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0930COG1418arCOG01860Predicted HD superfamily hydrolasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0930 nrc1 VNG0534 vng534 no entry
cHOG0930 hmu HMUK3081 Hmuk_3081 metal dependent phosphohydrolase
cHOG0930 hma RRNAC1822 hypothetical protein
cHOG0930 hwa HQ1712A hypothetical protein
cHOG0930 hla HLAC1197 Hlac_1197 metal dependent phosphohydrolase
cHOG0930 hbo HBOR23530 Hbor_23530 uncharacterized domain HDIG-containing protein
cHOG0930 hut HUTA0344 Huta_0344 metal dependent phosphohydrolase
cHOG0930 hvo HVO_0867 HVO_0867 HD domain protein
cHOG0930 nph NP1636A hypothetical protein
cHOG0930 hhi 2347 HAH_2347 metal dependent phosphohydrolase
MUSCLE (3.6) multiple sequence alignment


534|chp|nrc1       -----------------MAAFVRDYLEASVENETDGGRMRWYPWHSAEYRFTHIMNVVDI
1712|hp|hwa        MGVKIKESAISDTEFERMQQFVYDYLAASVEGDEDGGRMRWYPWHSAEYRFNHIQNVIEI
1197|gene|hla      MGVEIKETEVSDEDFEEMKGFVRDYLAASVESEEDGGRMRWYPWHSSDYRFNHILNVVDL
344|gene|hut       MGVEIREAPVSAAEFEEMKRFVHDYLEASVENEQAGGRMRWYPWHSAEYRFNHILNVVEL
23530|hp|hbo       MGVEIKESPVSAEEFETMQRFVKDYLAASVENEDDGGRMRWYPWHSAEYRFNHILNVVDL
1636|hp|nph        MGVEIRESPVSDEEFEEMKRFVRDYLAASVESEDEGGRMRWYPWHSAEYRFNHILNVTEL
11822|hp|hma       -----------------MKEFVHDYLAASVENEEEGGRMRWYPWHSAEYRFNHILNVVDI
2347|gene|hhi      MGVEIRESPVSADAFEDMKEFVHDYLAASVENEEEGGRMRWYPWHSAEYRFNHILNVVDI
                                    *  ** *** ****.:  ***********::***.** ** ::

534|chp|nrc1       AERIAEATSANVDVVRVAALFHDIAKLEAEQDAHAEEGARIARKYLETHGQFPPSFVDQV
1712|hp|hwa        ATTIADREGAAIDVVRVSALFHDISKLEANQEVHAEEGARVTREYLQTCDNLPQSFIDEV
1197|gene|hla      ATDIAEAEGADVDVVRVAAVFHDVAKLEAEQDVHAEAGARVAREYLQSRGNYPESFIEEV
344|gene|hut       ATDIAKQEGADVQVTRVAALFHDVAKLEAEQDEHAAAGARIAKEFLETHSDYPQSFVEQV
23530|hp|hbo       ASNIAEREGADVDVVRVAALFHDIAKLEAEQEVHAEEGARVAREYLSTHGDFPQSFIEQV
1636|hp|nph        ASKIAAEEGANVDVTRVAALFHDIAKLEAEQDVHAEAGARVAREYLRSRTDYPESFIDQV
11822|hp|hma       ATKIARKEGANVDVTRVAALFHDIAKLEAEQDLHAEAGARIAREYLRAHGDYPESFIEQV
2347|gene|hhi      ATKIARKEGANVDVTRVAALFHDIAKLEAEQDLHAEAGARIAREYLKAHGDYPESFIEQV
                   *  **   .* ::*.**:*:***::****:*: **  ***::.::* :  : * **:::*

534|chp|nrc1       AEAVSRHSYQGDLMDLPLEARCLVEADLLDKAGANGAALMLLRMGYEARTHVDAAEMIQR
1712|hp|hwa        CQSVAEHSYQGPLSDTSLETQSLIEADILDKIGANGTVLILLRMGYESRTHTDAAEMVDR
1197|gene|hla      CGAVVDHSYTGDLTDVPLESRCLMEADLLDKVGANGAVLMLLRMGYESRTHMDSAKMVDR
344|gene|hut       VAAIEDHSYQGDLTDLPLETRCLIEADVLDKVGANGTALLLLRMGYESRSHVDAPEMVER
23530|hp|hbo       CQVVADHSYQGPLSDVTLETRCLIEADILDKVGANGTVLMLLRMGYEARTHMDASEMVER
1636|hp|nph        CAAVADHSYEGDLDTMPLETQCLMEADLLDKVGANGTMLMLLRMGYEARTHMDANEMVGR
11822|hp|hma       CSAVEVHSYQGSLDDLPLEVQCLIEADILDKVGANGTALMLLRMGYESRTHMDAAEMVDR
2347|gene|hhi      CSAVDAHSYQGPLDDLPLEVQCLIEADILDKVGANGTALMLLRMGYESRTHMDAAEMVDR
                      :  *** * *   .** ..*:***:*** ****: *:*******:*:* *: :*: *

534|chp|nrc1       VLDRGEDAAERVESDAASSIAHRRLKRVRWLHDWLTSEVPAM------------------
1712|hp|hwa        VLERGRNAKERVVSDTAESIAYQRLKRVKWFREWLESEVPAMSTDANIEFTPDPTKADAH
1197|gene|hla      VLQRANDHTERVVSDTAEGIAHQRIKRVKWLREWLEEEVSRM------------------
344|gene|hut       VTERGTDARERIESDTAESYLHRRLKRVRWFKEWLEEEIAVV------------------
23530|hp|hbo       VLERGRAATDRIESESAESIAHQRLKRVKWFREWLEEEVPGM------------------
1636|hp|nph        VLERGEDAIARVRSDTAQSIAHQRIKRVRWFKEWLEGEVAGM------------------
11822|hp|hma       VIERGEDARERVQSDTAESLVHQRLKRTRWFQEWLTMEVAEMAVE---------------
2347|gene|hhi      VIERGEDARERVQSDTAESIVHQRLKRTRWFQEWLTMEVAEMAVE---------------
                   * :*.     *: *::*..  :.*:**..*:.:**  *:. :                  

534|chp|nrc1       --------------------------------------NDTGY---
1712|hp|hwa        TTHGDIDSNISVATGTDTDSTDTNTDTDTNPDTNNTNPVDTHISDR
1197|gene|hla      --------------------------------------DADGVTDR
344|gene|hut       -------------------------------------DAESEV---
23530|hp|hbo       ------------------------------------DREEFGV---
1636|hp|nph        ------------------------------------DPEDGAAAEL
11822|hp|hma       ---------------------------------DDLDDVATGMGDS
2347|gene|hhi      ---------------------------------DDLDDVATGMGDS