HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0093COG0111KOG0068arCOG01754Phosphoglycerate dehydrogenase and related dehydrogenasesphosphoglycerate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0093 nrc1 VNG2424 serA1 phosphoglycerate dehydrogenase
cHOG0093 hmu HMUK0793 Hmuk_0793 D-3-phosphoglycerate dehydrogenase( EC:1.1.1.95 )
cHOG0093 hma RRNAC2696 serA1 D-3-phosphoglycerate dehydrogenase
cHOG0093 hwa HQ1043A serA D-3-phosphoglycerate dehydrogenase
cHOG0093 hla HLAC2722 Hlac_2722 D-3-phosphoglycerate dehydrogenase
cHOG0093 hbo HBOR02900 Hbor_02900 D-3-phosphoglycerate dehydrogenase( EC:1.1.1.95 )
cHOG0093 hut HUTA1349 Huta_1349 D-3-phosphoglycerate dehydrogenase
cHOG0093 hut HUTA1491 Huta_1491 D-3-phosphoglycerate dehydrogenase
cHOG0093 hvo HVO_2968 HVO_2968 serA D-3-phosphoglycerate dehydrogenase
cHOG0093 nph NP0272A serA D-3-phosphoglycerate dehydrogenase
cHOG0093 hhi 3094 serA5 D-3-phosphoglycerate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


1491|gene|hut       ----MEIVVTSSVEDAGLAALTDAGHDVRTVSVDGAEELAVAAEGAAALIVDEETPVPAA
1349|gene|hut       ----MKVLVTDPIDDAGLARLRSAGLDVETDFDIDTAGVLEKIADVDAMLIR-GTEITRE
2424|gene|nrc1      ----MRVLVTDPIADAGLDRLRDAGHEVTTAYDATGDALLDAVSDAHALIVRSGTAVTDA
12696|gene|hma      ----MKVLVTDPIADAGLTRLREAGHDVETAYEVEGDALLDAVADANALIVRSGTEVTEE
3094|gene|hhi       ----MKVLVTDPIADAGLTRLREAGHDVETAYEVEGNALLDAVADANALIVRSGTEVTEE
1043|gene|hwa       --MHMQVLVTDPIDDAGLERLRAAGHGVETAYDIGDEALLNTITDVNALVVRSGTDVNEA
2900|gene|hbo       MITRMKVLVTDPIDDAGLERLREAGHEVETAYDVTGDALLDAVADANALVVRSGTEVTDA
2722|gene|hla       ----MKVLVTDPIADAGLDRLRDAGHEVVTDYEVEGDALLDAVSDANALIVRSGTDVNEA
272|gene|nph        ----MKVLVTDPIADAGLEVLRDAGHEVVTNYDAEGQDLLDAVSDANALIVRSGTEVTEE
                        * ::**..: ****  *  **  * *        :     .. *:::   * :   

1491|gene|hut       VFERATDVQIVGRTGIDVDGIDVATATEHGVIVANGPEADVQAVAEYIIGLLFATARGIP
1349|gene|hut       VFENAPNLKIVSRAGIGVDNIDIPAATDHGVIVANAPRGNVYAAAEHTIGLAFNAAKQIP
2424|gene|nrc1      VFEAAPDLVIVARAGIGVDNIDIDAATDHGVMVANAPAGNVRAAAEHTVALAFAAARSIP
12696|gene|hma      VFAAAPDLIIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHSVAMAFATARSIP
3094|gene|hhi       VFAAAPDLIIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHSVAMAFATARSIP
1043|gene|hwa       VFEAASDLIIVGRAGIGVDNIDIDAATEHGVIVANAPEGNVRAAAEHTVAMTFAGARSIP
2900|gene|hbo       VFEAASDLVIVGRAGIGVDNIDIDAATDHGVIVANAPEGNVRAAAEHTVAMAFASARSIP
2722|gene|hla       VFEAASELVIVGRAGIGVDNIDIEAATDHGVIVANAPEGNVRAAAEHTVAMTFAVARSIP
272|gene|nph        VLDAASDLVIVGRAGIGVDNIDIDAATDAGVIVANAPEGNVRAASEHTVAMTFATARSIP
                    *:  *.:: **.*:**.**.**: :**: **:***.* .:* *.:*: :.: *  *. **

1491|gene|hut       QGHVRLKDGEWAKGDIIGSELDGKTAGLVGFDSVGQEVAKRLDNLGLDVVVYAPDGDGER
1349|gene|hut       QAHMQVQAGGWDGASFDALELGDMTAGIVGLGRLGQEVAWRLDNLGMDLLAYDPYLGEAR
2424|gene|nrc1      QAHARLDAGSWAKDDYLGTELSGKTLGVVGLGRVGQEVATRLDSLGMDLVAYDPYIGEDR
12696|gene|hma      QAHDRLKSGEWAKGEFLGTEVNNKTLGVVGFGRVGQQVAKRLGGLGMDIVTFDPYISQER
3094|gene|hhi       QAHDRLKSGEWAKGEFLGTEVNNKTLGVVGFGRVGQQVAKRLGSLGMDIVTFDPYISQER
1043|gene|hwa       QAHARLRTGEWAKSEYLGTEVNGKTLGVVGLGRVGQEVAKRLESLGMDLVAYDPYISEDR
2900|gene|hbo       QAHARLKTGEWAKGDYLGTELNAKTLGIVGLGRVGQEVAKRLDGIGMDLVAYDPYIGEER
2722|gene|hla       QAHGRLLGGEWAKGEFLGTEVNNKTLTIVGLGRVGQEVAKRLDSLGMDLVVYDPYISEER
272|gene|nph        QAHTRLKGGEWAKGEFLGTELNGKTLGIVGLGRVGQEVAKKLDSLGMDLVAFDPYISEER
                    *.* .:  * *   .  . *:.  *  :**:. :**:** .* .:*:*::.: *  .  *

1491|gene|hut       AAQIGAER-VDLDTCLDRADFLSMHA---GADAIQLGERELDALGEAYLVNGTDGNVVDE
1349|gene|hut       ARQMGIEL-VELDELLERVDMLSVQARLTDETRGLIGPEEIDRFAGDLIVLTSRGGIVDE
2424|gene|nrc1      AAQLGAEL-VDIETCVARADFLTIHVPLTDETDGLIGEAELARMDGGYVINVARGGVVDE
12696|gene|hma      ADQFGAELVDDLEDCLAKSDFITIHTPLTPETENMIGEDELALLDGGYVVNCARGGIIDE
3094|gene|hhi       ADQFGAELVDELDDCLAKSDFITIHTPLTPETENMIGEEELAELEGGYVVNCARGGIIDE
1043|gene|hwa       AERLGAEL-VEFDTCLERAEFLTVHTPLTSETAGMISTTELELMDGGYLINCARGGVVDE
2900|gene|hbo       AERLGAKL-VEFEACLERADFLTVHTPLTPETEDLISTEELELMGGGYLVNCARGGVVDE
2722|gene|hla       ADRLGAELVEDLHEALGRGDFATVHTPLLPETEGMIGEDELAQLEGGYLINCARGGIVDE
272|gene|nph        AEQLGAEL-SDLDDVLERADVLTIHTPLTPETENMLGEAELAKMEGGYVVNCARGGIIDE
                    * .:* :   ::   : . :. :::.         :.  *:  :    ::  : *.::**

1491|gene|hut       SALANAAEDGDLQGAALDAVSVSPLPDDSPLRDVENILVTPEIASHTATNGESASASVAA
1349|gene|hut       PALADAVESGEIAAAGVDVFSTEP-PEDNPLLDVENVVVTPHLGAKTHNAQVNVAVTAAD
2424|gene|nrc1      DALADAAQDGVIAGAALDVFRTEPLPAASPLHDADSIITTPHLGASTKAAQENVATDTAD
12696|gene|hma      PALAEAVEDGVLKGAALDVFGEEPLPDDSPLLDVDDIIVTPHLGASTEAAQENVATSTAD
3094|gene|hhi       PALAEAVEDGVLKGAALDVFGEEPLPEDSPLLDVEDIIVTPHLGASTEAAQENVATSTAD
1043|gene|hwa       DALAAAVEDGVLDGAAVDVFADEPVAPDSALLSVDNIVVTPHLGASTEAAQENVATSIAD
2900|gene|hbo       DALAAAVEDGTLDGAAIDVFADEPVSPDNPLLDVDDVVVTPHLGASTEAAQENVATSIAD
2722|gene|hla       DALAEAVDDGILAGAALDSFAEEPLSQDSPLLDVEDIVLTPHLGASTEAAQENVAIDTAE
272|gene|nph        PALAAAVEDGTVAGAALDVFAEEPLPDDSPLLDVEDVIVTPHLGASTEAAQENVAVSTAE
                     *** *.:.* : .*.:* .  .* .  ..* ..:.:: ** :.: *     ..:   * 

1491|gene|hut       QVLAAFDGQPVSNAVNVPSIPPDAYPVVKPYADLTETVARIAIQLFDGDLESVSIEYAGD
1349|gene|hut       SIISALEGDLVQNALNLSSTDASSDPRTRGYVDVAETASKIALRLFEGRVESIEIEYAGD
2424|gene|nrc1      QVVAALAGDPVVNALNAPSAERSAFDRIRPFVDLAETAGTVAAALFDPRIERVDVTYQGE
12696|gene|hma      QIIAAANGQPVANALNAPSLDEATFKQVGPYLDLADTAGRIAVQLFGGHMSEVQVTYAGD
3094|gene|hhi       QIIAAANGQPVANALNAPSLDEATFKQVGPYLDLADTAGRIAVQLFGGHMSEVQVTYAGD
1043|gene|hwa       QIDAAFAGAPVMNALNAPSVDESVFPRIRPYIDLAETAGKIAAQLLDGRISSVSVSYEGD
2900|gene|hbo       QIDAAFNGEPVMNALNAPSVDKSAFPRIRPYIDLAETAGKVAAQLLDGRISNVEVSYEGD
2722|gene|hla       AVLAAFDDEPVLTALNAPSVDETAFPRIKPYIAVAETAGKVAAQLLDGRITGVETTYEGD
272|gene|nph        QVVAAFNGEPVMNALNAPSMDESAFPRVEPYIDLAETAGKIAVQLLDSRVENVEVTYEGD
                     : :*  .  * .*:* .*           :  :::*.. :*  *:   :  :.  * *:

1491|gene|hut       IVTETIEPITAAGLTGVFDPLGWDANQVNAR-HVADEHGIDVDVSTIREAPDFQNLVTVT
1349|gene|hut       LADEDTNLVTAA----VFNPFGWQDVVVDAPTRIAEQRGIQVVESKRRETEDYQSLVSIT
2424|gene|nrc1      VADEDVALVTAAAQQGAFAGLEWQVNAVNAP-RVAEERGIAVTETKNHRSEAYQSLVSVT
12696|gene|hma      IAEEDVEYVTASALKGVFASSDLQVNAVNAP-QIAKDRGIDVTESKTRTSEDYQSLITVT
3094|gene|hhi       IAEEDVEYVTASALKGVFAPSDLQVNAVNAP-QIAEDRGIDVTESKTRSSEDYQSLITVT
1043|gene|hwa       IADEDVELATASALKGVFEPLEWQVNAVNAP-QIAEERGIDVTESKRLQSDDFQSLVTVE
2900|gene|hbo       IAEEDIELVTASALKGVFEPLEWQVNAVNAP-RIAEERGIEVTESKTRQAEDFQSLVTVT
2722|gene|hla       IAEEDVDLVTASALKGVFEPLEWQVNAVNAP-RLAEERGIEVTESKTRQTEDFQSLVRVT
272|gene|nph        IASEDVELVTASALKGVFEPLEWQVNAVNAP-SIAEERGIGVSETKRRQAEDFQSLVTVT
                    :. *     **:    .*     :   *:*   :*.:.** *  :.   :  :*.*: : 

1491|gene|hut       VSGGGDELSVEGTQFADGEPRIVSIDRYWVEAIPHGHMLIVRNADEPGVIGFIGTVLGEY
1349|gene|hut       VSDGVRELTVSGTLFGDNEPRLVEIDGFRVDATPYGHMLISRNRDEPGVIGALGSVFGEY
2424|gene|nrc1      VGNGDAELTVSGTLFAGDDPRLVEIDGFRVEAAPNGHMLVARNHDTPGVIGFIGGVLGTA
12696|gene|hma      VSDGEESVSVCGTQFGGEEPRIVRIDDHRIEAVPHGHMLVVRNRDEPGTIGFIGTVLGEA
3094|gene|hhi       VSDGEESVSVCGTQFGGEEPRIVRIDDHRIEAVPHGHMLVVRNRDEPGTIGFIGTVLGEA
1043|gene|hwa       VSNGDDQLAVSGTQFTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEH
2900|gene|hbo       VGNDDESLSVCGTLFAGEDPRIVRIDGYRVDAIPHGQMLVARNYDKPGVIGFIGTVLGEN
2722|gene|hla       VRNGDDEIAVEGTLFAGEDARIVRIDGFRVDAVPYGHMLVARNTDEPGVIGLIGTVLGDY
272|gene|nph        VSDGEEEIAVCGTLFADDDARIVRVDGYRVDAIPGGKMMVARNTDEPGVIGHIGTVMGTY
                    * ..  .::* ** * . :.*:* :* ..::* * *:*:: ** * **.** :* *:*  

1491|gene|hut       DVNIAGMFNAREAI-GGEALSVYNLDDEPGEDVLAALNDDDRILETTVVELNGQNARE--
1349|gene|hut       DVNIAGMANARESI-DGEAMSVYNLDDPVTPELLEELESDTRVTGVTAIDLD--------
2424|gene|nrc1      EVNIAGMFNAREAR-GGEALTVYNLDADVPARALDELAGDDRIVDVTSIELNGE------
12696|gene|hma      DINIAGMFNGRETI-GGEALSVYNLDEQPPQDIIERLNDDSRIIETTYVELGDE------
3094|gene|hhi       DINIAGMFNGRETI-GGEALSVYNLDEQPPQDIIERLNGDSRIIETTYVELGDE------
1043|gene|hwa       NINIAGMFNARRDIEGGEALTIYNLDDSVPTDVVERLLADERMIDVRYLTLNGASDTK--
2900|gene|hbo       DVNIAGMFNARRSADGGEALTVYNLDDPIPEEVSEKLLADERITDVKYLTLNGTAE----
2722|gene|hla       DVNIAGMYNARETQ-GGEALTVYNLDQDVPDEAIEALLADDRIVEVTEITLDDADERPAE
272|gene|nph        DVNIAGMFNARETH-GGEALTVYNVDQEVPDEAREELESDDRIIETKYISLNG-------
                    ::***** *.*    .***:::**:*          *  * *:  .  : *.