HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0927arCOG04568hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0927 nrc1 VNG1046 vng1046 no entry
tucHOG0927 hmu HMUK2650 Hmuk_2650 conserved hypothetical protein
tucHOG0927 hma RRNAC0328 hypothetical protein
tucHOG0927 hwa HQ2699A hypothetical protein
tucHOG0927 hla HLAC1776 Hlac_1776 hypothetical protein
tucHOG0927 hbo HBOR17270 Hbor_17270 hypothetical protein
tucHOG0927 hut HUTA0660 Huta_0660 conserved hypothetical protein
tucHOG0927 hvo HVO_1512 HVO_1512 conserved hypothetical protein
tucHOG0927 nph NP4202A hypothetical protein
tucHOG0927 hhi 1066 HAH_1066 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1046|hp|nrc1      ----MSDGFN-LDLRRAEDELDT--PADFDGNVTLGVLDGTTPDEEWVEEVTRGNVLFLA
2699|hp|hwa       ----MSD-FN-LNLSGAESHLEQVTGDDFGGNVILGVLDGDTDPNEWLAAIEAGNVLVLN
10328|hp|hma      MYVAMSD-FEGLDLQAVEDQMDEDRDGAGSNRVVLGVLDGSESPDQWIDTIENGSVLVLN
1066|hp|hhi       MDVAMSD-FEGLDLQAVEDQMDEDRDGAGSNRVVLGVLDGSEPPEQWINTIENGSVLVLN
17270|hp|hbo      MGPGMSD-FN-LDLSSAEEHLD---EEELAGNVVLGVLNGETDPQTWIETIENGNVLFLA
1776|hp|hla       ----MSD-WD-LDLRDAEEQMDE--AFAAAGDVVLGVLDGTTDPDEWVRSIDYGNTLVLS
660|chp|hut       ----MGE-FD-LDLGAVESELPDADDGSPDGRVVLDVLDGTTPEGEWVDLVDDGAILVLN
4202|hp|nph       ----MGD-SD-LDLQTAEDELD---DLDTGGDVVLGVLDGTTDPDEWVAHVENDDVLVLN
                      *.:  : *:*  .*. :         . * *.**:*      *:  :  .  *.* 

1046|hp|nrc1      VDGDLNALAEGFAGTVKDAGGSLVHFREFLVVSPPDVDVDAGRL--
2699|hp|hwa       VDGDLNELAEPFARPVVDLGGNLTHFRGFLIVTPPDAGIDTDRV--
10328|hp|hma      VEGDLNELAAGFARPVREAGGELMHFRGFLIVTPPGVSIDSERLD-
1066|hp|hhi       VEGDLNELAAGFARPVREAGGELMHFRGFLVVTPPGVSIDSERLD-
17270|hp|hbo      VEGDLNELATGFAREIKDMGGQLMHFRKFLVVTPPGVDIDTDRL--
1776|hp|hla       VDGDLNELAAGFAREVKDMGGELMHFRGFLVVTPPGVTIDTDRLSE
660|chp|hut       VEGDVNERAAGFARDIRDAGGSLMHFRGFLVVTPPGIEIDTDRLS-
4202|hp|nph       IEGDLSELAAGFARDIRELGGELMHFRDFLVISPPGRDIDTDRLS-
                  ::**:.  *  **  : : **.* *** **:::**.  :*: *: