HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0925arCOG04600hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0925 nrc1 VNG1003 vng1003 no entry
tucHOG0925 hmu HMUK2360 Hmuk_2360 conserved hypothetical protein
tucHOG0925 hma RRNAC0750 hypothetical protein
tucHOG0925 hwa HQ2385A hypothetical protein
tucHOG0925 hla HLAC1211 Hlac_1211 hypothetical protein
tucHOG0925 hbo HBOR19520 Hbor_19520 hypothetical protein
tucHOG0925 hut HUTA2782 Huta_2782 conserved hypothetical protein
tucHOG0925 hvo HVO_1276 HVO_1276 conserved hypothetical protein
tucHOG0925 nph NP3378A hypothetical protein
tucHOG0925 hhi 1399 HAH_1399 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10750|hp|hma      ---MSDNRVVQGRMQTPESLAELIEGDGVMDAEPIEDADDDCPECGENVISVGYMPSALE
1399|hp|hhi       --------MVQGRMQTPESLAELIEGDGVMDAEPIEDADDDCPECGENVISVGYMPSALE
19520|hp|hbo      ----MSNRVVEGRMVTPKRLAELVEGEKPLEAESIEDADRDCPECDGNVISVGYMPSVTE
2385|hp|hwa       MHYRMSNRVVEGRMVTPERLAELVEGERPLEAEPIEDADRSCPECDENVISVGYMPSVTE
2782|chp|hut      ---MAENRVVQGRMVTAVKLAELIEDDDVMDAESIADADRTCPECGGDVLEVGYMPSITE
3378|hp|nph       MTRMSENRVVEGRMVTPQKLAELIEDDSVMDTEGIEDADRQCPECGGDVLSVGYMPGITE
1003|hp|nrc1      ---MADNRVVQGRMVTPKKLAELVEGTSVMDAEPISDADRDCPECGSDVLTVGYMPSVTE
1211|hp|hla       ----MSNRVVQGRMVTPEKLAELIEGDSILEAESITNADRDCPECGGDVISVGYMPSVTE
                          :*:*** *.  ****:*.   :::* * :**  ****. :*: *****.  *

10750|hp|hma      FVTGYKCQECDWSDTDRD-
1399|hp|hhi       FVTGYKCQECDWSDTDRD-
19520|hp|hbo      FVTAYKCQDCEWAETDRD-
2385|hp|hwa       FVTAYKCQECSWSDTDR--
2782|chp|hut      FVTGEKCQDCEWATTDRE-
3378|hp|nph       FVTGYKCQDCGWSETDR--
1003|hp|nrc1      FITGYKCQDCDWSARES--
1211|hp|hla       FITGYKCQECDWSADDREE
                  *:*. ***:* *:  :