HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0923COG2412arCOG04051Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0923 nrc1 VNG2470 vng2470 no entry
cHOG0923 hmu HMUK1241 Hmuk_1241 Protein of unknown function DUF424
cHOG0923 hma RRNAC3107 hypothetical protein
cHOG0923 hwa HQ3426A hypothetical protein
cHOG0923 hla HLAC2689 Hlac_2689 Protein of unknown function DUF424
cHOG0923 hbo HBOR01130 Hbor_01130 uncharacterized conserved protein
cHOG0923 hut HUTA1004 Huta_1004 Protein of unknown function DUF424
cHOG0923 hvo HVO_0111 HVO_0111 Protein of unknown function (DUF424) superfamily
cHOG0923 nph NP0996A hypothetical protein
cHOG0923 hhi 374 HAH_0374 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2470|chp|nrc1      -------------------------------------------------MTTPSPLVMRE
996|hp|nph         -----------------------------------------------------MTLLLCE
3426|hp|hwa        MTGSDRSDKEDILSESEDPLKPVPESNAEHDSNRDSVSTSTEAHDDNTETDDDEALLLRE
2689|gene|hla      -------------------------------------------------------MLLRE
1004|hp|hut        -----------------------------------------MTDDEGTDAPADAKLLLTE
1130|hp|hbo        -------------------------------------------------------MLLRE
13107|hp|hma       -------------------------------------------------------MILNE
374|hp|hhi         -------------------------------------------------------MILNE
                                                                          ::: *

2470|chp|nrc1      RHTDRGLLVAACDRDVLGETYDNGGTEFTVTESFYDGEAADA---DAVRAALARATIGNV
996|hp|nph         RSTPEGLLVSVCDADVLGETFDNGDVSLTVEPEFYDGETASH---EEVTASLADAAVANL
3426|hp|hwa        RQTPEGLLVAVCDSDCLGETYVDGEVSLNVTESFYGGSKADKVDAETVIKRLKRASVANI
2689|gene|hla      RETAEGRLVSVCDTDCLGETYDNGRATITVSEEFYGGDDAVEATAEEVVAGLHRAQVANI
1004|hp|hut        RETEEGLLVSVCDADVLGETFEDGELSLSVTEEFYGGDSAST---EAVAASLARCDTANL
1130|hp|hbo        RETPEGLLVSVCDRDCLGETYEDGQVSLEVTEEFYGGEEADKVDADAVVDSLTRATVANI
13107|hp|hma       RDTDEGLLVSVCDPDIMGETFENGPVSLTVNEEFYGGETATE---DEIVDSLARCSVANI
374|hp|hhi         RDTDEGLLVSVCDPDIMGETFENGPVSLTVNEEFYGGETATE---DEIVDSLARCSVANI
                   * *  * **:.** * :***: :*   : *  .**.*. *     : :   *  .  .*:

2470|chp|nrc1      VGDTAVGIAIDAGHVEAANVLELEGTVHAQFMQF-
996|hp|nph         VGHEAVGLAVEHGFVAEANVLEFEETVHAQYLRL-
3426|hp|hwa        VGKHAVAIAVEAGIVEKDRVLQIDETLHAQLVWM-
2689|gene|hla      VGTEAVGVAVEAGLVDEETVLEFDETRHAQLLWL-
1004|hp|hut        VGEMAVEIAIDEGFVDEANVLDIDGTRHAQLLWM-
1130|hp|hbo        VGERAVGVAIDAGIVDEETVLDVGETRHAQLLWMR
13107|hp|hma       VGDDAVNVAVEHGFVDEENVLDLGETRHAQLLWM-
374|hp|hhi         VGDDAVNVAVEHGFVDEENVLDLGETRHAQLLWM-
                   **  ** :*:: * *    **:.  * *** :.: