HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0092COG2423KOG3007arCOG01035Predicted ornithine cyclodeaminase mu-crystallin homologornithine cyclodeaminase

HOG Organism Gene ID Name Annotation
cHOG0092 nrc1 VNG2224 ocd1 ornithine cyclodeaminase
cHOG0092 hmu HMUK0978 Hmuk_0978 Ornithine cyclodeaminase( EC:4.3.1.12 )
cHOG0092 hma RRNAC0227 ocd3 ornithine cyclodeaminase
cHOG0092 hma RRNAC2941 ocd2 ornithine cyclodeaminase
cHOG0092 hwa HQ1386A ocd ornithine cyclodeaminase
cHOG0092 hla HLAC0439 Hlac_439 ornithine cyclodeaminase/mu-crystallin
cHOG0092 hbo HBOR27410 Hbor_27410 L-alanine dehydrogenase( EC:4.3.1.12 )
cHOG0092 hut HUTA1639 Huta_1639 Ornithine cyclodeaminase
cHOG0092 hvo HVO_0454 HVO_0454 ocd ornithine cyclodeaminase
cHOG0092 nph NP0448A arcB ornithine cyclodeaminase
cHOG0092 hhi 974 ocd3 ornithine cyclodeaminase
cHOG0092 hhi 202 ocd1 ornithine cyclodeaminase
MUSCLE (3.6) multiple sequence alignment


12941|gene|hma      -----------------MQTLLLGADAVEDHATMPAVIDAVAAAFAADARENTIMPAKSY
202|gene|hhi        -----------------MQTLLLGADAVEDHAAMPAVIAAVAAAFAADARENTIMPAKSY
1639|gene|hut       -----------------MDTSLLGPDTVTRLTDIEDVVRTVESAFAAHARGRSIMPAKSY
10227|gene|hma      -----MSNSLYSTARQDNQTTIVPSTDIEATVQMADLVPAIEAAFAAYENDTAQMPPKSY
974|gene|hhi        -----MSNSLYSTARQDNQTTIVPSTDIEAAVEMADLVPAIEAAFAAYENDTAQMPPKSY
448|gene|nph        -----------------METLLLDPDDVDAAADMAEVIVAVEEAFAAYERGDVQMPAKSY
1386|gene|hwa       MMSRQYIRLNGELYSMQRETLLLNATDVKQNAPMAEVVPAIEDAFAAFQRGDAQMPAKSY
439|gene|hla        -----------------MQTLLLNADDVDENARMDRVIDAVRGAFTAYERGNAKMPAKSY
27410|gene|hbo      --------------MYKMQTLLLNNDDVHENANMTELVPAIEEAFAAFERGDAQMPPKSY
2224|gene|nrc1      ------------------------------------------------------MPAKSY
                                                                          **.***

12941|gene|hma      IDLPQYNGDFRSMPAYVNA--------ETWDAAAVKWVNVHLDNPRDHDLPTVLGTLIYS
202|gene|hhi        VDLPQYNGDFRSMPAYVNA--------ETWDAAAVKWVNVHLDNPRDHDLPTVLGTLIYS
1639|gene|hut       VELPAYSGDVRSMPVYLDIHPEDGPAEDAWDAAAVKWVNVHPDNPADHDLPTVMGTIIYT
10227|gene|hma      IDLPQHNGDFRSMPAYLET--------DDWEASGIKWVNVHPDNPDEFDLPTVMGTLVYT
974|gene|hhi        IDLPQHNGDFRSMPAYLET--------DDWEASGIKWVNVHPDNPDEFDLPTVMGTLVYT
448|gene|nph        IDLPEYNGDFRSMPAYMEA--------DDWDAAGIKWVNVHTDNPDEYDLPTVMGTMVYS
1386|gene|hwa       IELPQYNGDFRSMPAYLDA--------GTWDAAGIKWVNVHTDNRDNFDLPTVLGTMIYS
439|gene|hla        IDLPEYNGDFRSMPAYLDVRTEDTAEDAGWDAAGIKWVNVHTDNPADHDLPTVMGTMIYS
27410|gene|hbo      IDLPQYNGDFRSMPAYMDA--------GDWDAAGIKWVNVHPDNEEQFDLPTVMGTMVYS
2224|gene|nrc1      VDLPQYNGDFRSMPAYMDA--------GDWDAAGIKWVNVHPDNPADHDLPTVMGTMVYS
                    ::** :.**.****.*::           *:*:.:****** **  :.*****:**::*:

12941|gene|hma      DPETAFPLAVMDGTVLTRLRTGAAAAVATDHLAVADADSLGLVGAGTQAYTQLDAISAVR
202|gene|hhi        DPETAFPLAVMDGTVLTRLRTGAAAAVATDHLAVADADSLGLVGAGTQAYTQLDAISSVR
1639|gene|hut       DPETGFPLSVMDGTTITRLRTGAAAAVATKYLASEDATSLGLVGAGRQAYTQLEAIATVR
10227|gene|hma      DPESGFPLAVMDATTLTMKRTGAAAAVATDHLAVEDATSLGIIGAGVQSYTQLEAISQVR
974|gene|hhi        DPESGFPLAVMDATTLTMKRTGAAAAVATDHLAVEDASSLGIIGAGVQSYTQLEAISQVR
448|gene|nph        DPRNAFPLSIMDGTTLTRKRTGAAAAVATDHLAIEDANSLGIVGAGVQSYTQLEAISVVR
1386|gene|hwa       DPETAFPLAILDGRELTMQRTGAAAAVATDYLAVPDASSLGIVGAGVQSYTQLEAISQVR
439|gene|hla        DPETAFPLAILDGTTLTMKRTGAAAAVATDELAVPDATSLGIVGAGVQSYTQLEAIAAVR
27410|gene|hbo      SPETAFPLALMDGTELTMKRTGAAAAVATDHLAIEDASSLGIIGAGVQSYTQLEAIATVR
2224|gene|nrc1      DPETAFPLALMDGTELTMKRTGAAAAVATDHLAVADATSFGVVGAGVQAYTQLEAISKIR
                    .* ..***:::*.  :*  **********. **  ** *:*::*** *:****:**: :*

12941|gene|hma      NIETVVVADRDTEKQQAFVDTFTDRFDVRAGSIEDAAGCDVLSTITPVESPIVDRKWLGE
202|gene|hhi        DIETVVVADRDAEKQQAFVDAFADQFDVRAGSIEDAAGCDVLSTITPVESPIVNREWLGE
1639|gene|hut       EIDRVVVSDRRSVAAQALVDHFADRFDVREGTIEEAATCDILSTTTPVEEPIVHA--VGD
10227|gene|hma      PIESVIVSDLDDDRVQRFIDTFGDEFDVRAGTISEAAQCDVLSTVTPVEDPIVTLEDLGE
974|gene|hhi        PIESVVVSDLDDDRVQRFIDTFGDEFDVRAGTISEAAQCDVLSTVTPVEDPIVTLEDLGE
448|gene|nph        DIDEVVVADKRDEAVEAFIDHFGDEFDVRRGSIAEAASCDVLSTVTPVRSPIVSADDLAD
1386|gene|hwa       PIETVVVADRDDTRVAEFIEAFDTEFDVHAGSVSDAAGCDVLSTVTPVEDPIIPREAVGD
439|gene|hla        DIDEVVISDLDEERVADFIDAFEGRFDVRAGSIAEAGHCDVLSTVTPVESPIVGPDDVGD
27410|gene|hbo      DIQEVIVSDLDEERVARFIDTFEDEFDVRAGSIEEAASCDVLSTVTPVEDPIVSRDAVGD
2224|gene|nrc1      DIEEVVVSDVSDDAVQQYVDHFSDRFDVRGGSISEAGHCDILSTVTPVEDPIVTAEDVGD
                     *: *:::*         :: *   ***. *:: :*. **:*** *** .**:    :.:

12941|gene|hma      RTHVNAIGADAAGKQEHSERTLLDAKLVIDNYEQCTHSGEINVPWGEGTLTDTDLHGELG
202|gene|hhi        RTHINAIGADAAGKQEHDERTLLDAKLVIDNYEQCTHSGEINVPWGEGVLTDTDLHGELG
1639|gene|hut       RTHLNAIGADATGKHEISDEVLTDARIVIDDYAQCTHSGEINVPYSDGTLTDADIDAELG
10227|gene|hma      HTHVNAMGADAEGKQELHTEVIREATLVIDDFEQTTHSGEINVPWSTGEIDESDIDAELG
974|gene|hhi        HTHVNAMGADAEGKQELHTEVIREATLVIDDFEQTTHSGEINVPWSTGEIDESDIDAELG
448|gene|nph        HTHINAMGADAPDKNELEQDVVTDARIVIDDHEQCTHSGEINVPWSEGVLDDADISAELG
1386|gene|hwa       HTHINAMGADAPGKHELADEILFDAMIIIDDHEQTTHSGEINVLWQANQLDESDINASIG
439|gene|hla        HTHVNAMGADAEGKHELADDLLLNATVVIDDHEQCTHSGEINVPYAAGLLTDDDIYGEIG
27410|gene|hbo      HTHINAMGADAEGKHELADEVLLDAKLVIDDHEQTTHSGEINVPYNEGVLSDDDIHAAIG
2224|gene|nrc1      HTHINAMGADAEGKHELADDILLAGTLVIDDHAQTTHSGEINVPYHEDTLADDDIDAEIG
                    .**:**:**** .*:*     :  . ::**:. * ******** :  . : : *: . :*

12941|gene|hma      DIVAGTLSGRTDD-------------DGITLFDSTGLAIQDVAAAHVVYENASDDGDGTA
202|gene|hhi        DIVAGTLSGRTDD-------------DGITLFDSTGLAIQDVAAAHVVYENASDDGDGTP
1639|gene|hut       DVVAGNVAGRTDG-------------DGVTLFDSTGLAIQDVAAAHVVYERAREVTAGDS
10227|gene|hma      EIVVGNAPGRDDL-------------SGISVFDSTGLAIQDIAAARIVYESLGDD-SGHR
974|gene|hhi        EIVVGNAPGREDL-------------SGITVFDSTGLAIQDIAAARIVYESLGDD-SGYR
448|gene|nph        EIVVGDEPRRRDS-------------DGVTVFDSTGLAIQDVAAARAVYERATADGAGTS
1386|gene|hwa       EVVLNQHQGRDQK-------------TGISVFDSTGLAIQDVATAHVVYEHACANGNGYN
439|gene|hla        EIVVGNRPGRTGTGSEGDNAGSGAGIDGVTVFDSTGLAIQDVAAARVVYEQADDNDNGYP
27410|gene|hbo      EIVVGDEEGRTDE-------------DGISVFDSTGLAIQDVAAAHIVYEHARENDNGYE
2224|gene|nrc1      EIVVGNADGRTDS-------------DGVTVFDSTGLAIQDVAAAHVVYEHASEHDNGYE
                    ::* .    *                 *:::**********:*:*. ***       *  

12941|gene|hma      FSLVDTETS--
202|gene|hhi        FSLVDTDTS--
1639|gene|hut       YELIDTDPGR-
10227|gene|hma      LEMV-------
974|gene|hhi        LEMV-------
448|gene|nph        FGLVDTKLR--
1386|gene|hwa       FDLLGFAEAD-
439|gene|hla        FDLLGLGE---
27410|gene|hbo      FDLLGLSGRDD
2224|gene|nrc1      FDLLGV-----
                      ::