HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0913COG0053KOG1485arCOG01474Predicted Co/Zn/Cd cation transporterscation efflux system protein (zinc/cadmium)

HOG Organism Gene ID Name Annotation
cHOG0913 nrc1 VNG1862 cef cation efflux system protein (zinc/cadmium)
cHOG0913 hmu HMUK1513 Hmuk_1513 cation diffusion facilitator family transporter
cHOG0913 hma RRNAC3425 cef
cHOG0913 hwa HQ3206A cation transporter ( substrates zinc/cadmium)
cHOG0913 hla HLAC1199 Hlac_1199 cation diffusion facilitator family transporter
cHOG0913 hbo HBOR09740 Hbor_09740 cation diffusion facilitator family transporter
cHOG0913 hut HUTA0076 Huta_0076 cation diffusion facilitator family transporter
cHOG0913 hvo HVO_2602 HVO_2602 cation efflux system protein
cHOG0913 nph NP3196A tp38 zinc/cadmium/cations transporter
cHOG0913 hhi 653 cef cation efflux system protein (zinc/cadmium)
MUSCLE (3.6) multiple sequence alignment


9740|gene|hbo       -------------------MRRVGLVILAVNVGLALAKAGVWWTTGSLAVGSEAVNSASD
76|gene|hut         -------------MTRRRTLRRVGLLLFGANLALFVAKGVVAVETGSLAVQSEAINSLAD
653|gene|hhi        -------------MSRRATLRRVGLLVLGVNLLLVLLKASVWLTTGSFAVQSEAVNSAAD
3206|gene|hwa       -----------MSDDRQTVVRRVGAVILVVNLVLVIAKSGVWLITGSLAVGSEAINSLTD
1862|gene|nrc1      -------------MERKRAVRRVGALVLAANLALVAAKGAAWWATGSLAVGSEAINSLAD
1199|gene|hla       -------MWRPWGSDEKARFQRTAGVNVIGNAVKIIVEGSVGVYFGSVALVADAAHSVAD
3196|gene|nph       MRTTAAEEAGLETETARRRFSRASLVNVAGNAVKILVEGAVGLAFGSVALLADAAHSVAD
                                       . *.. : .  *      :. .    **.*: ::* :* :*

9740|gene|hbo       AVYSVIVLAGLYLTTQPPDFEHPHGHERIEPFVSLFVAVGVFAAGAGVLWNASTSVLNGT
76|gene|hut         TVYSLVIVGGLYLTTRPPDFEHPHGHERIEPFVSLFVAAGIFLAGGAVIYQSGTALLAGD
653|gene|hhi        TAYSLVIVAGLYLTTRPPDFEHPHGHERIEPFVSLFVAAGIFSAGGFVLWNAGTALLTGN
3206|gene|hwa       SAYSLVILTGLYLTTQPPDFKHPHGHERIEPFVSLFVAAGIFIAGGAVLWNAAEAIQAGT
1862|gene|nrc1      VAYSLVVLGGLYLTTQPPDFKHPHGHERIEPFVSLVVALGVLAAGGAVLWQATTTVAAGD
1199|gene|hla       LVASAVVFVWGGSRYDAADETHPHGHQRIEPLTALLVGATIAVLGLVLLRESIRGLIGAH
3196|gene|nph       LVASAVVLVWGRSVYTDPDENHPHGHQRVEPLAALFVGSLIVLLGLNLFYESATGLVAGP
                     . * ::.         .*  *****:*:**:.:*.*.  :   *  :: ::   :  . 

9740|gene|hbo       YGGSAGVTGVAVLVVSGGVKYGLYRYCLRVGEQTHSPAIIATALDNRNDILTAGAALVGV
76|gene|hut         IESLRSPAAIGVLVVSIGAKLALYRYCLAVGRTWQSPALVATALDNRNDVLTAGAALAGV
653|gene|hhi        ISVTQGPAAVLVLAFSAVAKYALYRYCLRAGTDRNSPALIATAKDNRNDILTAGAALVGV
3206|gene|hwa       YGIKTDLTAVGVLIGTAVVKYGLYRYCCHVGSEHHSPAVTAAALDNRNDILTASAALIGV
1862|gene|nrc1      YGPTPGLPAVGVLVGTAVAKYALYRYVLGVAADHRSPALRATALDNRNDILTASAALVGV
1199|gene|hla       SPPRQSLLLIGALLFAMADMYLLYWYTERVNADLGSTALDALAVDCLNDIYTTIAALVGV
3196|gene|nph       -EVQFHPLLVGALLFAMADMYLLYWYTTHINESVGSSALEALAIDCRNDIYTTIAALCGV
                             : .*  :      **.*         *.*: * * *  **: *: *** **

9740|gene|hbo       LGASAGVPILDPIAAGVVSLGIIYTGYEIVRDNVNYLVGAAPPDELTAEILSRALEHPEV
76|gene|hut         IGAAVGAPILDPLAALVVAIGILHTGVEVVRDNVNYLVGAAPPDELRKEILRTALDHPDV
653|gene|hhi        GGAMAGYPIADPLAALVVAIGIIYTGIEVVQENVTYLVGGAPPEDLRREILRRALDHPQV
3206|gene|hwa       LGSSIGAPVLDPIAAIVVSVGIFYTGYEIVRDNISYLVGAAPPETLRREILEEALTHPDV
1862|gene|nrc1      LGSATGYPVLDPLAAFVVAAGILHTGYEIVRDNVNYLVGAAPPADLREQILGRALDNPDV
1199|gene|hla       FGVFLDVPILDPIAGALVSVFVVYQGIDIGRENVTYLVGAAPPVGDRERITAALRENPAV
3196|gene|nph       IGVFFGYPLFDAVAGGLVSVLVVYQGFEISRENVSYLVGASPSDQQRQRVVETLTDHPAV
                     *   . *: *.:*. :*:  :.: * :: .:*:.****.:*.      :      :* *

9740|gene|hbo       KGAHDVVAHYVGPEIDVSLHIEVEGDMTLFEAHDIESKVVESIGELPEVDDVFVHIDPKE
76|gene|hut         KGAHDVIAHYVGPEIDVSLHVEVEGHRTLREAHDIESAVVQSVEELQQVDDAFVHVDPKE
653|gene|hhi        RGAHDVIAHYVGPEIDVSLHIEVEGDLTLFEAHDIETAVIKSIEELPEVDDAFIHVDPKE
3206|gene|hwa       RGAHDVVAHYVGPEVDVSLHIEVEGNLTLTEAHNIESAVVESVEDLRSVDDAFVHVDPRE
1862|gene|nrc1      EGAHDVVAHYVGPEIDVSLHVEVEGEMTLHEAHDIETDLILDLESIPEVDDVFVHVDPKE
1199|gene|hla       EGVHDLTVYYDGTDLEVEVHVEVDGQMTLREAHDIETELVTGLRNLEDVGDVHVHLDPSG
3196|gene|nph       HGAHDVAVFYDGTDIEVEAHVEVDGELTLVEAHDIETELVSALRSLESVGDVHLHLDPAG
                     *.**: ..* *.:::*. *:**:*  ** ***:**: ::  : .: .*.*..:*:**  

9740|gene|hbo       LGEWKEDDRTEQLFEQRTGEK-------
76|gene|hut         LGEWKTDEAVDQLVETTEETTDRADDGR
653|gene|hhi        LGEWKDDEEVERLADLE-----------
3206|gene|hwa       LDEWKDDPDANRLVKEPRVSDDRG----
1862|gene|nrc1      LGEWKDADTAPE----------------
1199|gene|hla       LGEWKEAADGGDRGDKDGDDEA------
3196|gene|nph       IGEWKDAAVNEQRGPETQTGSPKQ----
                    :.***