HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0912COG0516 COG0517 COG0516KOG2550 KOG1764arCOG00612inosine monophosphate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0912 nrc1 VNG1001 guaB inosine monophosphate dehydrogenase
cHOG0912 hmu HMUK2358 Hmuk_2358 inosine-5'-monophosphate dehydrogenase( EC:1.1.1.205 )
cHOG0912 hma RRNAC0748 guaB3 inosine-5'-monophosphate dehydrogenase
cHOG0912 hwa HQ2382A guaB IMP dehydrogenase 1
cHOG0912 hla HLAC1209 Hlac_1209 inosine-5'-monophosphate dehydrogenase
cHOG0912 hbo HBOR19570 Hbor_19570 inosine-5'-monophosphate dehydrogenase( EC:1.1.1.205 )
cHOG0912 hut HUTA2784 Huta_2784 inosine-5'-monophosphate dehydrogenase
cHOG0912 hvo HVO_1273 HVO_1273 guaB inosine-5'-monophosphate dehydrogenase
cHOG0912 nph NP3384A guaB_1 IMP dehydrogenase 1
cHOG0912 hhi 1397 guaB2 inosine-5'-monophosphate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


2784|gene|hut       -------------------------------MAKNNRPFSAKLEVPEALTFDDVLLRPKE
1209|gene|hla       ---------------------------MTVYMATDSGRFSAKLDVPEALTFDDVLLKPKE
3384|gene|nph       --------------------------------MASDEPFSEKLRVPEALTFDDVLLRPKE
10748|gene|hma      -------------------------------MANDSEPFSEKLRVPEALTFDDVLLRPKE
1397|gene|hhi       --------------------------------------------MPEALTFDDVLLRPKE
1001|gene|nrc1      MVVSPTYLRPVTFAQSRNAFAVSHRPFDMANDSSTDGRFSEKLRVPEALTFDDVLLRPAE
2382|gene|hwa       ----------------------------MEKNVSEGGQFSEKLRVPEALTFDDVLLRPME
19570|gene|hbo      ----------------------------MANDVSERESFSEKLQVPEALTFDDVLLRPME
                                                                :***********.* *

2784|gene|hut       SRVEPDDATTETHVSKNVSLNVPVLSAAMDTVTESDMAIAMARHGGLGVIHRNMDVDRMV
1209|gene|hla       SRVEPDDADLSARVSKNVELTVPVLSAAMDTVTESDLAIAMAREGGLGVLHRNMTVEETA
3384|gene|nph       SRVEPDDADMATRVSTNVSLNIPVISAAMDTVTEAELAIEMARQGGLGVLHRNMSVEETA
10748|gene|hma      SRVEPDEADTTTRVSKSVELTVPVVSAAMDTVTESDMAIAMARQGGIGVLHRNMNADQMA
1397|gene|hhi       SRVEPDEADTTTRVSKSVELTVPVLSAAMDTVTESDMAIAMARQGGIGVLHRNMNADEMA
1001|gene|nrc1      SRVEPDDADVATRVSTNVELEVPVLSAAMDTVTESRLAIAMAREGGLGVLHQNMDTDRVV
2382|gene|hwa       SRVEPDAADVSTRVSRNVELNIPIVSAAMDTVTESGTAIGMAREGGLGVLHRNMDTPQMI
19570|gene|hbo      SRVEPDDADVSTRVSKNVELNVPILSAAMDTVTESGMAIGMAREGGLGVLHRNMDIEAMV
                    ****** *   :.** .*.* :*::*********:  ** *** **:**:*.**      

2784|gene|hut       TEIERVKRADELIIR--DVVTADPDQTVRDVDAMMQRQGVSGAPVVGDDD-EVLGIISAT
1209|gene|hla       EEVERIKRAHELVIRREDVVTVSPDDTVREADAVMERQGVSGAPVVDEDD-AVLGIISGT
3384|gene|nph       QHVEEVKRADELIIR--DVVTASPDQTVREVDAMMERKGVSGAPVVDDDD-TVLGIISGT
10748|gene|hma      TEIERVKRADELIIR--DVVTASPNQTVREVDEMMEHEGVSGAPVVDDDNGEVLGIISGT
1397|gene|hhi       TEIERVKRADELIIR--DVVTASPNQTVSEVDEMMEHEGVSGAPVVDDDNGAVLGIISGT
1001|gene|nrc1      AEVERVKRADELVIDRENVVTAAPEQTVEAVDEMMDRSDVSGAPVVDDDD-TVRGIISAT
2382|gene|hwa       AEIEQVKRADELVIRRENVVTASPTQTVREVDAMMEREGVSGAPVVDGDD-TVLGIISGT
19570|gene|hbo      AEIERVKRADELVIRRENVVTARPGQTVRDVDEMMEREGVSGAPVVDEED-VVLGIISGT
                      :* :*** **:*   :***. * :**  .* :*:...*******. ::  * ****.*

2784|gene|hut       DIRPYLEVGDSDAVREAMTDEVITTEADVSPREALELMYEHKIERVPIVDEENRLIGLVT
1209|gene|hla       DIRPYLEVGEDDAVSEAMTDEVITAPENVEAREALELMYDHKIERVPIVDGDDGLVGLVT
3384|gene|nph       DIRPYLEVGEHDSVQEAMTDEVITATEEVSPREALELMYEHKIERVPIVDDENRLTGLVT
10748|gene|hma      DIRPYLEVGEDDAVTDAMTDEVVTAPEDVTPREALELMYDHKIERVPIVDGENRLVGLVT
1397|gene|hhi       DIRPYLEVGEDDAVTDAMTDEVVTAPEDVTPREALELMYDHKIERVPIVDDENRLVGLVT
1001|gene|nrc1      DIRPYLEVGESDAVREAMTDEVITAPEDITARDALELMYEHKIERVPIVNDEQHLVGLVT
2382|gene|hwa       DIRPYLEVGDSDAVSEAMTDEVVTASLTVDARDALELMYDHKIERVPLVDKSNRLVGLIT
19570|gene|hbo      DIRPYLEVGESDEVREAMTDEVITAERDVTARDALELMYDHKIERVPVVDEEGHLVGLVT
                    *********: * * :******:*:   : .*:******:*******:*: .  * **:*

2784|gene|hut       MQGILQRREYDQAARDGNGRLRCGVAVGPFETERAIAADDAGADVIFIDCAHAHNLDVVD
1209|gene|hla       MQGILQRREHEEAARDEDGRLLAGVAVGPFEEERAVAADGADVDVIFIDCAHAHNLNVLD
3384|gene|nph       MAGVLARREYDNAARDDDGALVVGVAVGPFELERARAADAAGADIVFIDCAHAHNLDVID
10748|gene|hma      MQGILQRREYDQAARADDGSLRCGAAVGPFEMDRAQVADEAGADILFIDCAHAHNANVIE
1397|gene|hhi       MQGILQRREYDQAARADDGSLRCGAAVGPFEMDRAQVADEAGVDILFIDCAHAHNANVIE
1001|gene|nrc1      MQGILERREHGSAARDQNGRLRVGVAVGPFDTERATAVDEAGADVLFIDCAHAHNLNVID
2382|gene|hwa       MQGILQRRQHEDAIRDDDGRLRVGAAVGPFETDRAVAADEAGADILFIDCAHAHNLNVLD
19570|gene|hbo      MQGILQRREHEHAARDDDGRLVCGVAVGPFETDRAEAADEAGADVLFIDCAHAHNLNVLD
                    * *:* **::  * *  :* *  *.*****: :** ..* *..*::********* :*::

2784|gene|hut       TARDIKAEIDADIVVGNIGTREAAEDLVDFADGLKVGIGPGSICTTRIVSGSGMPQLSAV
1209|gene|hla       SARAIKETVEADVVVGNVGTREAAEAAVDFADGLKVGIGPGSICTTRVVSGAGMPQMTAV
3384|gene|nph       SAREIREEVDADVVVGNIGTREAAEAVVDFADGVKVGIGPGSICTTRVVSGSGMPQITAV
10748|gene|hma      SAREIKAEVDADVVVGNIGTREAAEAVVDFADGVKVGIGPGSICTTRVVTGSGMPQITAV
1397|gene|hhi       SAREIKAEVDADVVVGNIGTREAAEAVVDFADGVKVGIGPGSICTTRVVTGAGMPQITAV
1001|gene|nrc1      SAREIKASVDADVVVGNVGTREAAEAVVDFADGIKVGIGPGSICTTRVVTGSGMPQITAV
2382|gene|hwa       NAREIKTTVGADVVVGNIGTREAAEAAVDFADGLKVGIGPGSICTTRVVSGAGMPQITAI
19570|gene|hbo      SAREIKQSVEADVVVGNIGTREAAEEAVDFADGLKVGIGPGSICTTRVVSGAGMPQITAV
                    .** *.  : **:****:*******  ******:*************:*:*:****::*:

2784|gene|hut       AEVADVAADHDVPVIADGGIRYSGDAIKAIGAGADAVMLGSYFAGTDEAPGRIITRNGKK
1209|gene|hla       SQVADVAAEHGVPVIADGGIRYSGDAIKALAAGASAVMLGSYFAGTDEAPGRVITMQGKK
3384|gene|nph       AEVADVASQHDTPVIADGGIRYSGDAIKAIAAGADAVMLGSYFAGTEEAPGRVITMNGKR
10748|gene|hma      AQVADVASQHDVPVIADGGIRYSGDAIKAIAAGADAVMLGSYFAGTDEAPGRVITMNGKK
1397|gene|hhi       AQVADVASQHDVPVIADGGIRYSGDAIKAIAAGADAVMLGSYFAGTDEAPGRVITMNGKK
1001|gene|nrc1      SQVADVAAPAGVPVIADGGIRYSGDAAKAIAAGADAVMLGSYFAGTDEAPGRVITMNGKK
2382|gene|hwa       AEVADVAAPAGIPVIADGGIRYSGDAIKAIAAGADAVMLGSYFAGTDEAPGRVITMNGKK
19570|gene|hbo      AEVADVAAPEGVPVIADGGIRYSGDAIKAVAAGADAVMLGSYFAGTDEAPGRVITMNGKK
                    ::*****:  . ************** **:.***.***********:*****:** :**.

2784|gene|hut       YKQYRGMGSVGAMKSGGGERYLKDVEDQEEEDYVPEGVEAATPYQGPVENELHQMVGGMQ
1209|gene|hla       YKQYRGMGSVGAMKSGGGDRYLKE--EDEDEEFVPEGVEAATPYKGSLASELHQLTGGMC
3384|gene|nph       YKQYRGMGSVGAMNDGGGDRYLKD--DEEDEEFVPEGVEAATPYKGPLSSELHQLVGGMQ
10748|gene|hma      YKQYRGMGSVGAMNEGGGERYLKD--DEEGEEFVPEGVEAATPYKGSLASELHQLVGGMQ
1397|gene|hhi       YKQYRGMGSVGAMNEGGGERYLKD--DEEGEEFVPEGVEAATPYKGSLASELHQLVGGMQ
1001|gene|nrc1      YKQYRGMGSVGAMQSGGSDRYLKD--DDEDEEYVPEGVEAATPYKGSLASELHQLVGGIQ
2382|gene|hwa       YKQYRGMGSVGAMKSGGGDRYLKE--ADEDDEFVPEGVEAATPYKGTLASELYQLVGGMR
19570|gene|hbo      YKQYRGMGSVGAMKSGGGDRYLKD--ADDDEEFVPEGVEAATPYKGTLASELHQLVGGMR
                    *************:.**.:****:   :: :::***********:*.: .**:*:.**: 

2784|gene|hut       SGMGYVGAESVPEFQERAEFVRVSSAGQQENHPHDVLITDEAPNYSPGE-
1209|gene|hla       SGMGYVGAETIPELHDRAEFIRVSSAGQTEGHPHDVMITDEAPNYSPNE-
3384|gene|nph       SGMGYVGAETIPEFKERSEFVRVSSAGQTESHAHDVVITDEAPNYSPDSN
10748|gene|hma      SGMGYVGAETIPEFKQRAEFVRVSAAGQQESHPHDVMITDEAPNYSPDN-
1397|gene|hhi       SGMGYVGAETIPEFKQRAEFVRVSAAGQQESHPHDVMITDEAPNYSPDS-
1001|gene|nrc1      SGMGYVGAESIPAFKADAEFVRVSAAGQTEGHPHDVMITDEAPNYSPQGE
2382|gene|hwa       SGMGYVGAETLPGFKERSEFVRVSSAGQTEGHPHDVMITDEAPNYSPKGN
19570|gene|hbo      SGMGYVGAETIPDFKERAEFVRVSSAGQTEGHPHDVMITDEAPNYSPQND
                    *********::* ::  :**:***:*** *.*.***:**********