HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0911arCOG04599hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0911 nrc1 VNG1002 vng1002 no entry
tucHOG0911 hmu HMUK2359 Hmuk_2359 conserved hypothetical protein
tucHOG0911 hma RRNAC0749 hypothetical protein
tucHOG0911 hwa HQ2384A hypothetical protein
tucHOG0911 hla HLAC1210 Hlac_1210 hypothetical protein
tucHOG0911 hbo HBOR19530 Hbor_19530 hypothetical protein
tucHOG0911 hut HUTA2783 Huta_2783 conserved hypothetical protein
tucHOG0911 hvo HVO_1274 HVO_1274 membrane protein putative
tucHOG0911 nph NP3380A hypothetical protein
tucHOG0911 hhi 1398 HAH_1398 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3380|hp|nph       MSTSRHPVALRLERRVGEGTRLLGTVMALPLLDGIFAALVVAGAVSSVLGMIEVGLLIFG
1210|hp|hla       MSVSRHPVALRLEQRVGSATKLLATVMVLPLVDGIFPALVVAGVLTTATGVIETGILIFG
2783|chp|hut      MSSSQHPIALAIERRVGGDGRLLATVMCLPLVDGVFPALILAGAVGSFSGIFEVGLLVFG
2384|hp|hwa       MSVSRHPVALRLEQQVGSTTRLLATVMALPLVDGIFPALIIAGALDSPLGILETGLLIFG
19530|hp|hbo      MSVSQHPVALRLEQQVGGATRLLATVMALPLVDGIFPALVIAGALSTPVDIIQTGLLIFG
1002|hp|nrc1      MSSSRHPVALRLEQQVGGATKLLATVTLLPLVDGIFAALVLAGALDTWAGVLQTGLLVFG
10749|hp|hma      MSSSRHPIALDIERQVGRGGRLLATVMGLPLVDGIFPVLVLAGALSTWMGVLEVGLLVFG
1398|hp|hhi       MSISRHPIALDIEQQVGRGGRLLATVMGLPLVDGIFPVLVLAGALSTWMGVLEVGLLVFG
                  ** *.**:** :*..**   .**.**  ***:**:*..*::**.: :  .:::.*:*:**

3380|hp|nph       GSATLAVVLAEMEGSRRDRVRNILLVGALVVPFAAVQAAIAPTIESLLAMDIFKRFAALV
1210|hp|hla       GSATAAVILAEMDGSRRQMAGSVLLIGAIIIPLAALEAAFAPTFREFLNLLVFERFAGLV
2783|chp|hut      GSATVAVILADMDGSPREQALTVAGVGVVLLPIAALEAALAPTIASVLDLAIFERFAGLV
2384|hp|hwa       GSATVAVILAEMDGSRREQVRSVLILGAILLPVAGVEALFAETLKSVLDFAVFHRFAGLV
19530|hp|hbo      GSATVAVILAEMEGTRREQMTSVLILGVVLLPIAGLEAAFAPTIKTLLDFHTFHRFAGLV
1002|hp|nrc1      GSATLAVILAEMDGTRREQATSVLIVGVPLIVIATAEAALAPTVDTVVDIHTFERFAALV
10749|hp|hma      GSATVAVVLAELEGGPRQQARSVLIIGAVLMPIALVEAALAPTVAGLVELGTLERFAGLV
1398|hp|hhi       GSATVAVVLAELEGGPRQQARAVLIIGAVLMPIALIEAALAPTIAGVVKLGTLERFAGLV
                  **** **:**:::*  *:    :  :*. :: .*  :* :* *.  .: :  : ***.**

3380|hp|nph       ILAVAAKTASATIGEYLPGPGVIIALGLVASFQPNGFAVAVVAEPMYVVYGTGAALVGVG
1210|hp|hla       ILTIAAKTASSEIGEYLPSPGVIISLGLVASFEPSGFALRTSPE--YVLNGAAAAGVGVA
2783|chp|hut      ILAIAAQTASSQLADVIPRPAVIVGFGLVASLDLNGAEFSVATDPGLVINGTAAALVGVG
2384|hp|hwa       ILAVAAKTASAKVGEYLPSSSIIIGLGLVASVDLNNASLIIDPNIETIAQAVAAAGVGVG
19530|hp|hbo      ILAVAAKTASSEVGEKLPSPSIIIALGLVASFNPANAQLKTNPDPTIILHAVAAAGTGVG
1002|hp|nrc1      ILAIAAKTASATIGEYLPSPSVIIGLGFLASASPANARLVTQYENGLLLHAAAAAGVAVT
10749|hp|hma      ILAIAAQTASARIGEYLPRPAVIVVLGLLASLDPAGATLVTAIEPGVLLRAAATTGVGIG
1398|hp|hhi       ILAIAAQTASARIGEYLPRPAVIVVLGLLASLDPAGATLVTAIEPGVLLRAAATTGVGIG
                  **::**:***: :.: :* ..:*: :*::** .  .  .    :   :  ...:: ..: 

3380|hp|nph       FALAVALLGPWLRGNVDIDRFRFGSAVALGVLPLTIL--EVGPITGEEPLALIVLALTGL
1210|hp|hla       FALAIALLSPHLRGRVDIDRFRFGSAVALGVLALPILLGPFDIMQTEAPIALAVLGVTTL
2783|chp|hut      FALLVALTGPWLRASVDLDRFRFGSAVALGVLALSVY----GLVPSDAPLSLAVLAMAGL
2384|hp|hwa       FALIVALFAPRLRGVVELDRFRFGSSVALGMLALDIL----GLLPTEAPVALGVLCVTAV
19530|hp|hbo      FALVVAMLGPRLRGVVDINLFRFGSSVALGMLAIDVL----GVLPTDRPIALGVLGVTAL
1002|hp|nrc1      FALVVVALGPALRRVVDIDRFRFGSAVALATLALSVF----NLVPSQAP--LMVFAVAGL
10749|hp|hma      FALAVALASPWLRNAVDIDRFRFGSAVALGVLALSVL----GVMPTDAPVALAVLAVTAL
1398|hp|hhi       FALAVALASPWLRNAVDIDRFRFGSAVALGVLALSVL----GVMPTDAPVALAVLAVTAL
                  *** :.  .* **  *::: *****:***. *.: :     . :  : *  * *: :: :

3380|hp|nph       LAFNP-DGA--LEIGPQETPDTG--------------------V-----PAATDGSGVDD
1210|hp|hla       FAYDPNAGPAGDSADDGAGDDPDGDDAPDIDDADEIDDGIVTDD-----DAERDGDTEPT
2783|chp|hut      LAFDPDRDLLFPADDAGREPENE--------------------------ASLPDGGDQSD
2384|hp|hwa       FAYDP--DS--PTVGNSVAAAGHAV------GSDRP-------E-----TTASETVPSSS
19530|hp|hbo      FAYDPAADD--PAEDAELDADTNGIESEDSHESDDPDTYEQESDDASAPAAVADGGNRDG
1002|hp|nrc1      LAFDP-DQA--ASDDAEAAPDGEG-------GPDGI-------T-----VPADDGPDARA
10749|hp|hma      LSFDP-ENA--RTRHTEYRPDAV-----------DL-------T-----AAFADGGASQG
1398|hp|hhi       LSFDP-ENA--RTRHTEYRPDAV-----------DL-------T-----AAFADGGASQG
                  ::::*                                             .  :      

3380|hp|nph       ESP---------------LEDPLDEPSGSDDDQSEDGEPG-VSDGDRAPWL
1210|hp|hla       EPPLDAPTAPAPIVDDDVAVIANGGDPSGRSDDADDTDPF-ADDDSRAPWL
2783|chp|hut      APN------------------TVGTDT--------------KNSDDRSPWL
2384|hp|hwa       SPS------------------ESTPDSDSDSGETGYGFP--DDSDSHAPWL
19530|hp|hbo      SASVSDDGNQSQ------RQNQNQSQPDDESGDAGYGYP--AEKDSRAPWL
1002|hp|nrc1      TPP------------------ATDGGNGHEPDEAAYGYPGEDTAEERAPWL
10749|hp|hma      VAA------------------DEQTDEG-----AAVEY---EPDQERAPWL
1398|hp|hhi       VAA------------------DEQTDEG-----AAVEY---EPDQERAPWL
                   .                                           ..:***