HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0910COG3428arCOG04619Predicted membrane proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0910 nrc1 VNG1353 vng1353 no entry
cHOG0910 hmu HMUK2114 Hmuk_2114 membrane-flanked domain
cHOG0910 hma RRNAC0955 hypothetical protein
cHOG0910 hwa HQ1496A hypothetical protein
cHOG0910 hla HLAC1204 Hlac_1204 membrane-flanked domain protein
cHOG0910 hbo HBOR21800 Hbor_21800 predicted membrane protein, COG3428
cHOG0910 hut HUTA0354 Huta_0354 membrane-flanked domain
cHOG0910 hvo HVO_0953 HVO_0953 Bacterial membrane flanked domain family
cHOG0910 nph NP2780A hypothetical protein
cHOG0910 hhi 1584 HAH_1584 membrane-flanked domain-containing protein
MUSCLE (3.6) multiple sequence alignment


10955|hp|hma       ---MNRLHPRSAVLSVARAALQGGFFGFFGGSVGTGMLGLPAFAVPLLGL--------LG
1584|gene|hhi      ---MNRLHPRSAVLSVARAALQGGFFGFFGGSLGTGMLGLPAFAVPLLGL--------LG
1353|chp|nrc1      ----MKLHPLSVPVRALSRALGFGWAFLIG---GAALSGGNAA---LTGVAVLGVM--VA
1496|hp|hwa        MTQIRTLSPVSIPYRILQRSGSIAFALIFV-LSGQGGALPELPVIGVVDSTFIGAIAVAI
21800|hp|hbo       -MVTQHLSPLSVPYRVLQRGGSIVAALGFALATG----GFSLPFAGITGPLVLVGLASLF
1204|gene|hla      ----MKLAPQSVPYRALQKVSGIVVLLFFI-VNNNPDWGFAVAAA-IVGA---------V
354|gene|hut       ----MRLDPLSIPYRIAENSARIGGAIVVAGIAGSGGSGGNM----LQGAAIFLGIAAIG
2780|hp|nph        ----MKLHPFSVPLRAIESVISLAWVLIIA-ILGSPALGGTS----AVGV-----IVAAW
                         * * *                 .    .              .           

10955|hp|hma       ALTFGGYALARYFRFRYELDGDTLTVESGVFARQSRQIPLGRVQNLDVEQNILNRLLGLA
1584|gene|hhi      ALTFSGYALARYFRFQYELDGDTLTVESGVFARQSRQIPLGRVQNLDVEQNILNRLLGLA
1353|chp|nrc1      VVAVVAYEIAYYRRFDYELTEDSLDIASGVFSRREREIPLRRVQNVDVTRSLVARLLGLA
1496|hp|hwa        VLIFVGYETAYVRRFQYKLTTDSLDIDSGVLSRRNREIPLRRIQNVDISRNIIQRGLNIA
21800|hp|hbo       AIALVAYEFAYYRRFTYELTADTFDIESGVFARRNREIPLGRIQNVDISRNVIQRAMGIA
1204|gene|hla      VLAAIAYEVAYYRRFDYELTEDTLDISSGVISRREREIPYRRIQNVDVSRSVIQRALGVA
354|gene|hut       VALVAGWEIAYHRRFRYELTADTFDIESGVFSRRDREIPYRRIQNVDIRQNVVQRLLGIA
2780|hp|nph        FVIALAYQLIYYQRFEYELTADTLDMASGVISRRRREIPIQRVQNVDISRNVLQRAFGVA
                        .:      ** *:*  *:: : ***::*. *:**  *:**:*: ..:: * :.:*

10955|hp|hma       IVRFETAGGSATEATLDAVDEAEVKRLRNYVRTHDRDEAAESAAETAGAVSGTATSGRSA
1584|gene|hhi      IVRFETAGGSATEATLDAVDEAEVKRLRNYVRTHDRDQAAEAETATADAVSEAATPGRSA
1353|chp|nrc1      VVDVETAGGGSTEASLRFVSREAAADLQADV-RTRRTTPGDAADAATAATPDAGGADSES
1496|hp|hwa        VVSFETAGGESTEATLRFVSAEEAKRLQREVGRRKHDKSDTRTSETVDSSEDDQTGNKDE
21800|hp|hbo       AVSFETAGGTETEAKLRFVSFEEAKRLQRELGRLKRGESADEDADT--------------
1204|gene|hla      AVDLETAGGSSTEGSIRFVTPDEATRLQREVQRRKSAGSTGPNGETGAGAETGTGDETGR
354|gene|hut       EVRLETAGGGQTEAQLSYVNREEAGRLQEEVGRHKRADEPDAGEEADD------------
2780|hp|nph        QINLETAGGSSTEASLRYVSVEEAQRLQSEIGRLKRGQTQREAERSAE------------
                    : .*****  **. :  *    .  *.  :              :              

10955|hp|hma       HADLPGVTGPTPAHTGDAQTANDFEDSASASDTEPRDQPDGSLLFAFDQRELLTYALVSV
1584|gene|hhi      HADLPGVTGPKPTHTGDTQSRNDLGEPVSESDTAERDEPDGSLLFAFDQRELLTYALVSV
1353|chp|nrc1      RSAADRAREPTPV------------------------GERGELLFALSNRDLLLYGLLSF
1496|hp|hwa        TSGGSP-------------------------------DRTVNELFVLDDGELALVGFFSI
21800|hp|hbo       --------------------------------------PVAEELFKLEGRELGILGALSF
1204|gene|hla      RTGSEAGAGPGRV------------------------GPAEEELFAISPGELALVGALSF
354|gene|hut       --------------------------------------HSAETLYSITPRELGILGIVSM
2780|hp|nph        --------------------------------------PEQE-LFSITSKELGLLGVVGI
                                                            . *: :   :*   . ...

10955|hp|hma       RPAAPVLTLASLPLGMD-VVWAVLRFNATLVGASLNGPVIRWLASSPESTRLVVFAAI-S
1584|gene|hhi      RPAAPVLTLASLPLGMD-VVWAVLRFNATLAGASLSGPVVRWLTGSPETTRLAVFAVL-S
1353|chp|nrc1      NPRLFSGIIAVATVAAP-SLGGRMAVPD---------VGMVVLVAGA----VALALGV--
1496|hp|hwa        DLRVPGLLVAGLSTLGP-ILTGLVPAASPLRSLLTVIGGPSVLTGGV----NALLGLLPV
21800|hp|hbo       DFRVPGIIFLFFSGSLT-VVTSLFPSDL----------GPVVVVLGT----FVLLLLV--
1204|gene|hla      DGRLIGLLAFLGSGSVP-VLSSFVPDAS-----------AIALTATA----IVGVGAL--
354|gene|hut       DLRLVPLVLVALSVFGPAAITSVLPEID------------QWFLIGP----LVGFGSI--
2780|hp|nph        DLRLLSFVTVLLPVVSP-SLREQFADPL-----------VGLAVTAP----LAAAAIV--
                               .      :   .                            .    :  

10955|hp|hma       LVQFLLLALVVSVALTVIEYYGFRLTQADGDLRYERGLLRRYSGNIPLEKVQTVTIRENV
1584|gene|hhi      VVQFLLLALVVSVALTVIEYYGFQLTQADGDLRYERGLLRRYSGNIPLEKVQTVTIRENV
1353|chp|nrc1      --------WLVSAAVRVVQFYGFRLRRVGGDLRYERGLFERRDGTIPLSKLQTVSVEDSV
1496|hp|hwa        LIGVVVLSWLVGAASAVTSYYGFRLTETRGELRYERGLFQRYDGSIPFEKIQTLTVEDDP
21800|hp|hbo       ----ILASWITGAAIAIVNYYGFRLVQSADELQYERGLLQRYDGSIPFDKVQTLTIADNP
1204|gene|hla      ----FLVSWVLGAGVAFSNYYGFRLSRAGDELRYERGLFRRYSGSIPTEKVQALRIADNP
354|gene|hut       ----VGLAILSGI-ISMLQYYDFQLGTHGDEYRYERGLLQRYSGSIPVEKVQTLSIRENV
2780|hp|nph        ----VVTAGISGI-LAVMNYYGFRLARQNDELLYERGLLQRFSGAIPLSKVQTLTVSENF
                            : .    . .:*.*.*    .:  *****: * .* ** .*:*:: : :. 

10955|hp|hma       LMRRFGYATLAVETAGYSGGN----QQSTQGVAVPLAPREEVYELARDIEPFGDLDFDRP
1584|gene|hhi      LMRRFGYATLAVETAGYSGGN----QQSSQGVAVPLAPREEVYELARDIEPFGDLDFDRS
1353|chp|nrc1      LMRRYGFASLAVETAGYAPGQ---SPSGGSEAAVPIAPRAAVFELAREIEPVADIDLSRP
1496|hp|hwa        LKRYFGYATLYVETAGYAPGQ-SGSGGRGSEVAVPLAQRDRIDELIKRIEPVDTIELRRP
21800|hp|hbo       LKRWAGYATLLVETAGYAPGQGDSGSSRGSEAAVPIASRERIEDLVNDIEPVGSPDFRRP
1204|gene|hla      AKRALGYASLSIETAGYAPGQ---GGEQGSQAAVPIATTDRVYRLAREVESFGDPRFTRP
354|gene|hut       LARWLGYASLTIETAGYAPGQ---GSGARSQSAIPIAERDRVVELARSIESFGEVTFERP
2780|hp|nph        IARRLRYASLAVETAGYAPGD------RGSESAIPLAKRDRVFNLAQSVEDFTDVEFTRP
                     *   :*:* :*****: *:        .  *:*:*    :  * . :* .    : *.

10955|hp|hma       PKRARRRYLARFSLAAAGLTAVAYAVDSLVLATGYWWLAALLFLPVVPAAHFRWRHRGFD
1584|gene|hhi      PKRARRRYLARFSLAAAGLTAVAYAVDSLVLETGYWWVAALLFLTVVPAAHLRWRHRGYD
1353|chp|nrc1      PERAQDRYVRRYALAGLGVVAAGALVSRLV-VSFPWYALAVLVPLAVPAARRAHATRGVY
1496|hp|hwa        PKRARRRYLVRAGLIVGAVIIGLYTISTVMSITFPWWVAIGLLPVGGIIAIALWRHRGHW
21800|hp|hbo       PKRTRRRYFGRYSIVIGAATAVLSVAGSVASLGLPWYAPLALIPVAAVAAHYKWKHRGLW
1204|gene|hla      PKRIRWRYAFRYALVIGVVVAVAFGIDWFLGTGAPWYAPAALLLAVPPAAHLKWKHRGYW
354|gene|hut       PKRARERYAVRYLLVALVIIAGTYAVTFHPDVSGPWYFSAVILLIVPVAAHYKWRHRGYH
2780|hp|nph        PKRARERYAGRYSIIALIAVIVAFGADAYTDLTFAWYATLALFPLAAVAAHLKWLNLGYD
                   *:* . **  *  :                     *:    :.      *   .   *  

10955|hp|hma       LDGSVLATRSGFWRRTTRIVPYYRLQTVFVTRSPFQRRRDLATVGADTASSSSLLGGVAR
1584|gene|hhi      LDESVLATRSGFWRRTTRIVPYYRLQTVFVTRSPFQRRRDLATVGADTASSSSLLGGIAR
1353|chp|nrc1      SDSDHVVTQAGWWRRKTTVVPAHRVQTVLRKQTVFQRRWALTSVVIDTAGSRSLSGGGAV
1496|hp|hwa        ISEDYFVTRNGVFTRETRIVPLYRIQTVIDTRTVFQRRLGLATIIADTAGSRSLGGSDAQ
21800|hp|hbo       LGENHVVTRNGVLKRETKIVPYYRIQTVIDSRTIFQRRLRLATVTIDTAGSLSLGGQDVA
1204|gene|hla      LGEDHLLTRNGFWSRTVTVVPYYRIQNVIDARTIFQRRWDVATIIADTAGSSSIAGNDAA
354|gene|hut       LGEDYALTRNGFWSRRITIVPTYRVQTVLSSRTIFQRRRRLASVIVDTAGSSSLMGTDAV
2780|hp|nph        VQSEYIVLREGFWTRTITVVPYYRVQTVLDSQTVFQRRRRLATLVVDTAGSSGLTNRQPR
                      .    . *   *   :** :*:*.*:  .: ****  ::::  ***.* .: .    

10955|hp|hma       VYDIDEDTAKELRDTLRDRLTAHVAGLRTG------------------------------
1584|gene|hhi      VYDIDEDIAKELRDTLRERLTAHVAGLRTG------------------------------
1353|chp|nrc1      AIDRDGGDADALADDVVDCTLLSVGVRGDD------------------------------
1496|hp|hwa        AVDISAQRATTLRTELETRLQRAIHVRKDR-----------------------LGSMSTT
21800|hp|hbo       AVDIDTDYADELRDELESRLRVAVAAHRQGR----------------------VGIGADD
1204|gene|hla      AVDFATDEAVDLRETLRERLRVAVAKHRDRRDRFEWFDGDAEGSGEIDDSTPGVDEPTAD
354|gene|hut       AADIDAEQADRLREAVADRLQVAIGQRDSS------------------------------
2780|hp|nph        ALDIDEERAAELREEVADKLQEMVAYRREER-----------------------------
                   . *     *  *   :       :                                    

10955|hp|hma       ------------------------------------------------------------
1584|gene|hhi      ------------------------------------------------------------
1353|chp|nrc1      ------------------------------------------------------------
1496|hp|hwa        GVSSSKSSSDTVAN--NKDTIVTTESDNDGSKSQVTDTDDNSTTHDNDQPA----DNHNH
21800|hp|hbo       ELSVTESVEQSKSE--QDGT-------ADTAHSDPDDAVDNAADGATDGPS---------
1204|gene|hla      DETTSDEDDESRSDVPDDGVIRPNFSGSDRDYSEPAERIDTGEYAVDRSPSDMDGESGSG
354|gene|hut       ------------------------------------------------------------
2780|hp|nph        ------------------------------------------------------------
                                                                               

10955|hp|hma       ------------------DRG-DADA------------
1584|gene|hhi      ------------------DRASDADA------------
1353|chp|nrc1      ------------------TAAAGSAAD-----------
1496|hp|hwa        NDNYGGDDDGTEETRRSENETNDISNP--ESGSTEESE
21800|hp|hbo       -----------------DDATDDADPFVWDTASDDNSK
1204|gene|hla      TEEAGSGNDERDEKDDIDDAEDGADSA--DNDANDAEK
354|gene|hut       --------------------------------------
2780|hp|nph        ----------------REERVESMTAELADADPNPGV-