HOG Organism Gene ID Name Annotation
aHOG0908 hhi 1516 coxB2 cytochrome c oxidase subunit II
aHOG0908 hhi 803 coxB1 cytochrome c oxidase subunit II
MUSCLE (3.6) multiple sequence alignment


1516|gene|hhi      MRLRRRVIQAGLVVVGLSLLAAPATAQSVNRAAIDD----LNEQLLYVALPLTLFVELTL
803|gene|hhi       MTRKRAGLVALFGAALLALAAEPAAAAQIQDSTTDSLIWGLNMNLLYVALPITVLVEGIL
                   *  .*  : * : .. *:* * **:* .:: :: *.    ** :*******:*::**  *

1516|gene|hhi      VYVIYRFRNNDDPQPTVDDPALEVTWTAATGAILVFVGISAFVVMANPYITPAAAEASAG
803|gene|hhi       IYTVWRFRNQEEALPTQENRRLEVTWTIATAIILLFVGVASYQVMASPYVTAEAGDQAA-
                   :*.::****:::. ** ::  ****** **. **:***:::: ***.**:*. *.: :* 

1516|gene|hhi      GGDAFAEDTE-IDVLAYQWGWEFSY------AEANVTTEERLVLPADRNVTFRLRTTDVI
803|gene|hhi       ---LQEQDTELITVEAQRYGWTFYYNESSWDGEAEVTTTTDLKIPANQDVSLRVTSTDWL
                         :*** * * * .:** * *      .**:***   * :**:.:*::*: :** :

1516|gene|hhi      HAIYIPQLGVKQDVFPSRTITARTHATEPGEYRLYCAEMCGSGHSKMNATVVVKNQSAYD
803|gene|hhi       HAFHVPGLGLKSDAFPGQYNRLRTNAGNTGTYQLYCAEYCGSGHSQMLGTVEVVPQDEYE
                   **:::* **:*.*.**..    **:* :.* *.***** ******:* .** *  *. *:

1516|gene|hhi      AWMENQTASAD-------
803|gene|hhi       DWLAEQKSGGDDSEGSDE
                    *: :*.:..*