HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0907COG1845arCOG04650Heme/copper-type cytochrome/quinol oxidase subunit 3cytochrome c oxidase subunit III

HOG Organism Gene ID Name Annotation
cHOG0907 nrc1 VNG0662 coxC cytochrome c oxidase subunit III
cHOG0907 hmu HMUK1958 Hmuk_1958 cytochrome c oxidase subunit III( EC:1.9.3.1 )
cHOG0907 hma RRNAC0882 coxC cytochrome c oxidase subunit III
cHOG0907 hma RRNAC1399 cyoC cytochrome c oxidase polypeptide III
cHOG0907 hwa HQ2352A coxC cytochrome-c-like terminal oxidase, subunit III
cHOG0907 hla HLAC2853b Hlac_2853 cytochrome c oxidase subunit III
cHOG0907 hbo HBOR21030 Hbor_21030 heme/copper-type cytochrome/quinol oxidase, subunit 3( EC:1.9.3.1 )
cHOG0907 hut HUTA0305 Huta_0305 cytochrome c oxidase subunit III
cHOG0907 hvo HVO_1138 HVO_1138 coxC cytochrome c oxidase subunit
cHOG0907 nph NP2450A coxC cytochrome-c-like terminal oxidase, subunit III
cHOG0907 hhi 1974 coxC2 cytochrome c oxidase subunit III
cHOG0907 hhi 1519 coxC1 cytochrome c oxidase subunit III
MUSCLE (3.6) multiple sequence alignment


2853|gene|hla       MSDSRQPAGEPVRQG--------EGADGFPHGSKYPL---------FVGGGLFFIGLGLA
10882|gene|hma      -MAGSTEAGTE--------RVAED---GHEHRSRWPLLAAVGAASLYLSIGLVFVGLDLV
1519|gene|hhi       -MLRVHMAGST-ETATEHAAD-----NGHEHRSRWPLIAAIGAASLYLGVGLVFVGLDLV
2450|gene|nph       -MSVETDDGHGHGHG-HHLPAVEDWPKGFGEASWWPFIAALGGSGLYIGAALFVLGQPEH
2352|gene|hwa       -MGTEESHDD---HG-HHLPAVEDWPRGFGEASWWPFVTAVGAASVYVAAALYILGQSNS
21030|gene|hbo      -MGTEEAHDD---HG-HHLPAVEDWPRGFGEASWWPFVTAVGAAGIYAGAGLYILGRGEN
662|gene|nrc1       -MSVADDSTDD--HG-HHLPAVEDWPKGFGEASWWPFITAIGAAGFYIGAALYVLGRGES
305|gene|hut        -MSIVEDTDAG--DG-HHLPAEEDWPQGFGEASWWPFITAIGAAGIYLGAALWLLAGGDD
11399|gene|hma      -MSVSDEHADD-GHGEHHLPATEDWPHGFGEASWWPFVTAIGGSGIYVSAALLVLSMGEN
1974|gene|hhi       -MSVSDEHADD-GHGEHHLPATEDWPHGFGEASWWPFVTAIGGSGIYVSAALLVLSMGEN
                                               *.   *.:*:         : . .* .:.    

2853|gene|hla       WSWLFLI------IGIPVELYGLWGWTREYTIEEFERGVVPEQKRQLLGVETGLLGMYML
10882|gene|hma      PSVVPIVLGGA--GAIGL-LTGLAGWANEAFIADYL-RNRSGGDSDLYA-----TTMILF
1519|gene|hhi       PSVVPVVLGGA--GAVGL-LAGLAGWANEAFIADYV-RNRRDSDSDLYA-----TTMILF
2450|gene|nph       GVVSPLAGPLVFVLSTAAFLAGLYGWLYHAFIVDFWAGEADDHGFP-MK-----LTMLLF
2352|gene|hwa       DLVGPMVGPATMVVAVGIFLAGLYGWVYHAFVSHFWSRESSGQSANKLR-----WGMLAF
21030|gene|hbo      AIVGQMVGPAAFAGSVAIFLAGLYGWVYHAFVSHFWSRDASEKGANKLR-----WGMIAF
662|gene|nrc1       ALVGPMVGPGVFIASTFAFLAGLYGWVYHAFVAAYW--SNDGGGSTALR-----WGMIGF
305|gene|hut        PLVGSSVGPGAIIVSVFLFLVGMYGWLYHAFVVDFWHRGADPSASSGLR-----LGMLLF
11399|gene|hma      ALVSQTVGAGAMAGSVGLFLVGIYGWLYHAFVSDFWERGTDYHSDKTLK-----FAMLLF
1974|gene|hhi       ALVSQTVGAGAMAGSVGLFLVGIYGWLYHAFVSDFWERGTDYHSDKTLK-----FAMLLF
                                  .    * *: **     :  :                     *  :

2853|gene|hla       IVSEILIFAGFFVAWFYLDATRG-PFPPD--GYPG--LTVWLGATMTGLLLLGSLTARYG
10882|gene|hma      LVSDVATFSAGFVYYAFIRA--G-SWPPA--HLPP--LLGSLVVINTALLLASSVTLHYG
1519|gene|hhi       LVSDVATFSAGFVYYAFIRT--G-SWPPA--HLPP--LLGSLVVINTALLLASSVTLHYG
2450|gene|nph       LGTEVATFGAGFVYYFFIRA--D-AWANLPPIVADGNVLNALVIANTLILIASSVTMHYA
2352|gene|hwa       LGSELATFGALFGYYFYIRA--G-NWGSIFVGIPT--LTGSLVLINTTLLIASSVTLHYA
21030|gene|hbo      LGSELGTFGALFGYYFYIRA--G-DWNEILVGVPE--LTGSLVLINTALLVASSITLHWA
662|gene|nrc1       LGSEIATFGAGFAYYFFIRA--GTQWSTAASAIPDG-FLGSLVVVNTAILVVSSFTLHFA
305|gene|hut        LGSEIATFGAGFVYYFFIRA--G-AWPPD--HLPH--LLGSLVVVNTAILIASSVTLHVA
11399|gene|hma      LGSEIATFGAGFVYYFIVRG--GEVWTQA--AVPE--VFGSLVIVNTLLLIASSVTLHYS
1974|gene|hhi       LGSEIATFGAGFVYYFIVRG--GEVWAQA--AVPE--VFGSLVIVNTLILIASSVTLHYS
                    : :::  *.. *  :  :    .  :       .   .   *    * :*: .*.* . .

2853|gene|hla       RIAVVEEGDRSKLVLGYAMTVGIGVLFLAVLAFEWSNLLA-EGLRWTTGPYGATYYALAG
10882|gene|hma      HEA-LEDGNRDRFLGLLGVTLALGVVFLAGQVYEYYEFVAVEGFGIGSGAFGSAFYGLTG
1519|gene|hhi       HEA-LERGNRQRFLGLLGVTLALGVVFLAGQVYEYYEFVAVEGFSIGSGAFGSAFYGLTG
2450|gene|nph       HHA-LLKDNRKRFVRLLGATLLLGLIFLAGQTYEYYEFITVYGFGLTDGAYGSAFYALTG
2352|gene|hwa       HVA-IRNNKRKKFIGGLLGTLLLGIVFIGGQVYEYYEFIIHESFTLTSGIFASAFFGLTG
21030|gene|hbo      HVA-IRNNDRGKFLSGLAVTLLLGIIFIGGQVYEYYEFIVHSDFTITSGLFGSAFFGLTG
662|gene|nrc1       HVA-LRKGNRSRFLALLVSTLVLGVVFIGGQVYEYYEFIAHEGFTLSGGLFESAFFGLTG
305|gene|hut        HLA-LRRGNRRRFLQWLGVTLALGIVFIGGQAYEYYQFIVVDGFSLSTGTFGSAFYGLTG
11399|gene|hma      HIA-LRSGNRSRFLKLLGATLLLGIVFIGGQVYEYYEFIVHKGFSIGGGIYGSAFYGLTG
1974|gene|hhi       HIA-LRNGNRSRFLKLLGTTLLLGIVFIGGQVYEYYEFIVHKGFSIGGGIYGSAFYGLTG
                    . * :  ..* .::     *: :*::*:.  .:*: :::   .:    * : ::::.*:*

2853|gene|hla       LHAGHLIAGLVLFGIVIYRARVRDHFSANRNLMVRTAEAYWHFLTAISIAIFIFIYFGTT
10882|gene|hma      LHGLHVALGVLLLAIAFGRA-LRGHYAPERDTAIRTTSLYWHFVDLVWVFLVVVLYVGAA
1519|gene|hhi       LHGLHVALGVLLLAIAFARA-LRGHYAPERDTAIRTTSLYWHFVDLVWVFLVVVLYVGAA
2450|gene|nph       LHGLHVALGAVLLTILFIRA-IYGHYSPEKHVSVSTVSMYWHFVDIVWVFLVVVLYVGAI
2352|gene|hwa       LHGVHVSLGAVLIGVVTLRG-LLGQYSADRHVSVSTASMYWHFVDVVWIFLVVVLYLGAE
21030|gene|hbo      LHGLHVSLGAVLLGIVFIRA-LAGQYSAERHVSVSTASMYWHFVDVVWIFLVVVLYVGAE
662|gene|nrc1       LHGLHVTMGAVLIGIIMVRG-LRGQYSADRHTSVSTVSMYWHFVDIVWIFLVVVLYAGSV
305|gene|hut        LHGAHVTLGAVLIGIVFARG-MAGQYSEHRHTSVSTVSMYWHFVDAVWVFLVAVLYVGAA
11399|gene|hma      LHGLHVTMGAVLLGIVFIRG-YYGQYSAERHTSVSTASMYWHFVDIVWIFLVVVLYMGAN
1974|gene|hhi       LHGLHVTMGAVLLGIVFVRA-YYGQYSAERHTSVSTASMYWHFVDIVWIFLVVVLYMGAN
                    **. *:  * :*: :   *.   .:::  .   : *.. ****:  : : :. .:* *: 

2853|gene|hla       ------
10882|gene|hma      L-----
1519|gene|hhi       L-----
2450|gene|nph       V-----
2352|gene|hwa       VGA---
21030|gene|hbo      LGTGAF
662|gene|nrc1       A-----
305|gene|hut        A-----
11399|gene|hma      LV----
1974|gene|hhi       LV----