HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0905arCOG04547ABC transporter.ATP-binding protein homolog hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0905 nrc1 VNG0667 trp4 ABC transporter.ATP-binding protein homolog
cHOG0905 nrc1 VNG2202 vng2202 no entry
cHOG0905 hmu HMUK2799 Hmuk_2799 conserved hypothetical protein
cHOG0905 hma RRNAC0045 trp4 ABC transporter ATP-binding protein-like
cHOG0905 hwa HQ1576A hypothetical protein
cHOG0905 hla HLAC2851b Hlac_2851 hypothetical protein
cHOG0905 hbo HBOR21900 Hbor_21900 hypothetical protein
cHOG0905 hbo HBOR30880b Hbor_30880 hypothetical protein
cHOG0905 hut HUTA2486 Huta_2486 conserved hypothetical protein
cHOG0905 hvo HVO_1012 HVO_1012 trp ABC transporter ATP-binding protein homolog
cHOG0905 nph NP2444A hypothetical protein
cHOG0905 hhi 805 trp1 putative ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


30880|hp|hbo        --MTETISGPDALARRPTRTLRLLAGLIAVEILLVGVYLLTTEAAV---LSVRYVLYPFV
2486|chp|hut        ---MSTARRFGPIPTPSKSHLLWGALLVNTEVLLLFGYLSVSDSQLFDLASLRLYVYPFV
2851|hp|hla         MNLSAHTREWVSSVEIERRTARFWIVVVLLEGFLLLAYFALTTAEP--TTEVRYLVYPFV
667|gene|nrc1       ---MPTRTVSTSVVRPSRETLLTWAAVLNGELVAVLLYFALTTATP---TDTVAIVYPFV
10045|gene|hma      ---MSTTTATLRDAIPDTRSLVTWAAVLNAEFILILGYVVNTAQPA---TDPFLLVFPFI
805|gene|hhi        ---MSTTTATLRDAIPDTRSLVTWAAVLNAEFILILGYVVNTAQPA---TDPFLLLFPFI
1576|hp|hwa         ---MSVKKAFRTTQR--TQDLVYATLLGNSLIGLALGYLLIADITI---TQPRYTIYGLL
21900|hp|hbo        ------MSVTDTLRVAFDRDVLYAALLANTLGMLALVYVLVAEITV---TQPRYAFYGLL
2202|hp|nrc1        ------------------------------------------------------------
2444|hp|nph         ---------MTATDKDPNWTLIYTAIVANALVLAALGYALLAERQP-----TAYWAVPLV
                                                                                

30880|hp|hbo        WVNLGVLAVYSVDVPRPSGRRTAA-ATVVAVLYFGVLAWTTGLVGPGSGA-------DLS
2486|chp|hut        WINVSLWALATVR-PPAAPRRRKLFGGAVATGYALVLTYLGGLVSTAMTD-----GIGLS
2851|hp|hla         WINAGLWAVRRVT-PTPGTRTHRAVGIVIAIAYLFVVLYIPGTIGFGAT------GTPTD
667|gene|nrc1       WINVAVWAVRRVGVPSVASRRQAAVAAGVGVGYFLLLGGVGGLYMLQGA--------GLG
10045|gene|hma      WLNIAGLVALRVR-PELPSRRRTIGSVVIALGYLLVLGYVGGVYGTGGQ--------GTG
805|gene|hhi        WLNVAGLVVLRVR-PELTSRRRTLGSAVVALGYLLVLGYVGGVYGTGGQ--------GTG
1576|hp|hwa         WIFVGAIVIWKTN-PASADARTRRRATIVAIVYLSILSIVGGVIITTGGNAANALTQSFG
21900|hp|hbo        WIAVGVIAIWKTR-PAPTDEKTRQRARLIAVGYVVALAFAGGIVVSSLPS-----TAGWG
2202|hp|nrc1        ----------------------------------MVMGYVGP------------------
2444|hp|nph         WITVGVWALLRVS-PPPAARRTKALAGAVAGGYFLVLGFVGGLFGPASGP-----TTGLL
                                                        :                       

30880|hp|hbo        VRLVG-AMPGWGPILLVGGP-VNLTLVPFEVVGYVCLTALVYVSLVRATAGVFSGILGLA
2486|chp|hut        IRPLV-FPPGWAPVVSADIAGLSLTLLPYKVLGYITLSYLVYALVVEAA-GVLPAILGLF
2851|hp|hla         LRIAM-YAPGWGPLVAFTSPWLRLYLVPFEVLGYASLAYLVYANVLDLTRSTFSGALGLV
667|gene|nrc1       ARVAW-LSPGWGPALVYSGTAVTVSLIPFKLVGYATLAYLVAAAVADAARTGVAGLVGLA
10045|gene|hma      LRLVTQAPPGFSPTVVFSGATLSVVLIPWKVAGYLALSYLVFVTAVDASGGAVGGIVGLF
805|gene|hhi        LRLVTQAPPGFSPTVVFSGATLSVVLIPWKVAGYLTLSYLVFVTAIDASGGAVGGIVGLF
1576|hp|hwa         IRVAT-LLPGWGPAPIITTPIGAVVLMPARIVGYLALTYLVYATVIDAARAAVSGIVGLL
21900|hp|hbo        VRLAT-LAPGWGPAPVFTTPFFALVFMPARVVGYLALGYLVYATVIDASGSAVSGILGLL
2202|hp|nrc1        ---------------------LRVAAAPYRIGGYLALAYLVYATLADAEASLVGGLVGVF
2444|hp|nph         IQATE-LPPGWNPAVLYAGEYLQFAIIPYTAFGYGVLAYLIYVTAVEAKHAVAGGLLGLF
                                           .   *    **  *  *: .           . :*: 

30880|hp|hbo        TCVSCVGPVIAGVFSGVLGGASTALAGSMSGAYAYDLSTALFVVTVGIL---WYTLRE--
2486|chp|hut        SCVSCVWAAVVVPLAGTVGGST-ALASLVFG-GGYDLSTAIFVVSVVLLA--WRPTVG--
2851|hp|hla         TCVGCTVPVL-TPLVGVLGGPAAGLTTTAYA-WSYDIGTIIFLLTVGLLS--WSHRRSRS
667|gene|nrc1       SCVSCAWPVLGTLLAGLFGSTS-AAVTIAES-DPYGVSTVVFVSSVVVLL--WRPSW---
10045|gene|hma      SCVSCVLPILASILGGFVGVGA-TLSQAALS-QSYGLSTVVFVTSVGLLYGVHRFDVTLV
805|gene|hhi        SCVSCVLPIIASILGGFVGVGA-TLSQAALS-QSYGLSTVVFLVSVGLLYGVHRFDVTVI
1576|hp|hwa         SCVSCSWPVIASVLSGVLGGGS-AVAAIAVD-FSYDVSTVVFILTIALLY--WRPIVGRV
21900|hp|hbo        SCVSCSWPILASLLTGVFGSSS-ALVAATFD-LSYDISTLVFVVTVVLLY--WRPFGFGR
2202|hp|nrc1        TCVSCTLPVVAAVVSSLAGGAV-AVGTASA--LSYDAATAVFVLAVGLLA--WRPDAA-V
2444|hp|nph         SCVSCTLPVIAALVGGVVGGGG-AVAQAAIEFQSYAISTAVFVVTVGLLS--YRPGLGQF
                    :**.*  . :   . .  *               *  .* :*: :: :*           

30880|hp|hbo        ----------
2486|chp|hut        NRIDLGGGRR
2851|hp|hla         ----------
667|gene|nrc1       ----------
10045|gene|hma      GRLQALVDRP
805|gene|hhi        GRLRTLVGRP
1576|hp|hwa         GD--------
21900|hp|hbo        GE--------
2202|hp|nrc1        GRWLR-----
2444|hp|nph         RRWLS-----