HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0090COG2339arCOG02985Predicted membrane proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0090 nrc1 VNG2625 vng2625 no entry
cHOG0090 hmu HMUK0552 Hmuk_0552 conserved hypothetical protein
cHOG0090 hmu HMUK3157 Hmuk_3157 conserved hypothetical protein
cHOG0090 hma RRNAC2368 hypothetical protein
cHOG0090 hwa HQ1397A hypothetical protein
cHOG0090 hla HLAC0042 Hlac_42 hypothetical protein
cHOG0090 hbo HBOR27830 Hbor_27830 predicted membrane protein, COG2339
cHOG0090 hut HUTA1408 Huta_1408 conserved hypothetical protein
cHOG0090 hvo HVO_0408 HVO_0408 membrane protein putative
cHOG0090 nph NP0754A hypothetical protein
cHOG0090 hhi 2807 HAH_2807 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2625|chp|nrc1      MRKTGHMTADQDPVQRAADDDMDLYDVVTWEPRSRLDYAATWLYNALGTGLRPGVLVVAA
42|hp|hla          ------MPSRSDPVESRADDDRDLYDIATWEERTSLDGLSVALHWLITRSAKAIVVFVAL
1397|hp|hwa        ------MVRPQDPIEEAADDSLDLYDIATWEVRSRTDRIASVLWWLLAGSARVTVILIAL
27830|hp|hbo       ------MAEKQDPVERASDGAMDLYDISTWEQRTSVDGLASALYWLFRASSRFLIIAVAF
754|hp|nph         --MPADAFSMKDPVEARADTDEDLYDVADWEPRTALDRLAIRTYQGAIRASRRLLVFLGF
1408|chp|hut       -------MRQRDPVETAADGSLDLYDIADWEVRGRLDRLAVILHASALTLARVTIVLVAI
12368|hp|hma       -----MGKRRQDPVEANADGSADLYEISTWEPRSTLDRFAHWLYHIGIRTLRYLVIVAAI
2807|hp|hhi        -----MGKRRQDPVEVNADGSADLYEISTWEPRSRLDRFAHWLYHIGIRTLRYLVILAAI
                              **::  :*   ***::  ** *   *  :           .  ::  . 

2625|chp|nrc1      LIIVAQFATAT-GLVFFDRPVVGAYVLLSVAPALAVAGYIWLADATGQEPIELLVATFVF
42|hp|hla          LGLLAILGSFGLGL-VFD-PAVGMLVGLSAIPALGLAAYVYVSDVTTGEPLSLLVATFLL
1397|hp|hwa        TLLLAV---GGLAA-LTD-PQTGILTALSAIPAVGLAVYVSLTDITETEPILLLVATFLL
27830|hp|hbo       GLLVSI---GGFAA-ITD-LEIGLLTVLSAIPALGLAAYVYYSDITTGEPLVLLVGTFLL
754|hp|nph         VVLFVIIALSGAGGLILEDPFVLGLAALSVVPAALLAAYIYRADITTREPLSLLLATFIL
1408|chp|hut       SILLSQFVLGGLGA-ITD-PTVGAVTALSVVPAVGLAGYVWRADATAREPLGLLVATFLL
12368|hp|hma       LILLLQVAFGSLGA-VGDQPLFAGMAILSAVPALGLAAYIYYADVTTPEPLTLLVGTFLL
2807|hp|hhi        LILLLQVAFGSLGA-LSDQPLFAGMAILSAVPALGLAAYIYYADVTTEEPLTLLVGTFLL
                     :.        .  . :       . **. **  :* *:  :* *  **: **:.**::

2625|chp|nrc1      GFLFAGFAAAINAMSSVVLFGSSDPMTGSTAVATSALFYFLVVGPVEEIVKWLAVRLYVF
42|hp|hla          SILTATFAALLNSVAQPY-------F-QPFGFPGLVLFFFAIVGPIEESVKLLAVRLYAY
1397|hp|hwa        GVLTANFAAVLNTVLRPY-------F-RGLGFISSIVFFFLVVGPIEESVKLLAVRLYAY
27830|hp|hbo       SVLTASFAAILNSLIGGY-------F-EILGFAGTLLSFFLVVGPVEESMKLLAVRLFAY
754|hp|nph         AVLFAGFAAIINTAFI---------FLQLLPFFGLVLFFYLVVGPVEESVKLLAVWLYPY
1408|chp|hut       GVLFAGFAAVINAMFAPAAFVLTEAA-G-VEALGLVVVFYVIVGPVEEGVKLLAVRLHAF
12368|hp|hma       GVLFAGFAGILNGVFGTPVQAIGSGF-GLVPFLGQVFFFFLIVGPVEETVKQLAVRLYAF
2807|hp|hhi        GVLFAGFAGILNGFLGEPVQAIGSGF-GLVPFLGQVFVFFLIVGPVEETVKLLAVRLYAF
                   ..* * **. :*                        . :: :***:** :* ***.*. :

2625|chp|nrc1      RSDEFDTVVDGAVYGAMAGLGFATVENAIYILREVMS---------VMQTAGGQQATEVA
42|hp|hla          TDDRFDAVIDGAVYGAIAGLGFVVIENLVYIAQTVD----------LGELSLSIATLGAG
1397|hp|hwa        SDDRFNSVLDGAVYGAMAGLGFAVIENALYIARQLP----------SSGLDLGLGLIGAG
27830|hp|hbo       TDDRFNSVVDGAVYGAMAGLGFAFIENAIYITRELP----------VQNLDLSLGLLGMG
754|hp|nph         RDARFDSVVDGAVYGAVAGLGFAAIENVLYITQNLQTPAMVLATASANLLADFTETLAAG
1408|chp|hut       RDVRFDAVVDGAVYGAIAGLGFATIENALYITETTG--------------DVGVGVFAAG
12368|hp|hma       RDERFDTVVDGAVYGAAAGLGFATIENALYITQN------------AEMAAGTVELLAAS
2807|hp|hhi        RDNRFDAVVDGAVYGAVAGLGFATIENALYITQN------------AEMATGTVELLAAS
                    .  *::*:******* *****. :** :**                            .

2625|chp|nrc1      FQVAALRTLAGPGHVIYSAFAGYYLGLAKFNPDDAGPIVVKGLVTATLIHATYNTAVTNL
42|hp|hla          DGIAALRALAGPGHVIYSAFAGYYLGLAKFNPGNRGPIVVKGLIIAAAIHALYNTLVGPV
1397|hp|hwa        GGITAIRALAGPGHVIYSAIAGYYLGLAKFNPGQRGPIVMKGILLAAIIHATYNATVGIG
27830|hp|hbo       GSITAARALAGPGHVIYSAIAGYYLGLAKFNRENRGPIIIKGLLIAAFVHAMYNVTVGFG
754|hp|nph         GEITAIRGLAGPGHVIYSAFAGYYLGLAKFNRENAGPIVAKGLLIAAFIHATYNTLVGII
1408|chp|hut       GSVVTVRALAGPGHVIYSAFAGYYLGLAKFNPVQAGPIVVKGLLIAAFVHGTYNALVSVL
12368|hp|hma       SDITAVRALAGPGHVIYSAFAGYYLGLAKFNPDDAGPIVLKGLLIASVIHAVYNTLAGPV
2807|hp|hhi        SDITAIRALAGPGHVIYSAFAGYYLGLAKFNPDDAGPIVLKGLLIASLIHAVYNTLAGPV
                     :.: * ***********:***********  : ***: **:: *: :*. **. .   

2625|chp|nrc1      KPVAEFV--GVAQGVAFLVFVIAYDGVFLAVLGKKLRAYRAAYNHTGASAVAAHAATWDG
42|hp|hla          TTVLSVAT-GLPQLVSLFVFVLLFQGAFAYVLLRKLRRYRDAYLE-------TRDAV-DP
1397|hp|hwa        SGVIASIT-GLSGIVSYLIYVVFYDSIFGLILFIKIQRYRNSYQR-------VHSAD-KD
27830|hp|hbo       TVAIDLFT-PLSGLWASIAYVLIYDGIFGYFLIRKIRRYSRAYRQ-------AHMPTYDE
754|hp|nph         PGVASLLVPGVPVLVLFFGFVVIYQGLFLYLLYRKLKRYEGAYRR-------GHDGQHRA
1408|chp|hut       PAFLADVV-GISPFFAFVGFVIVYDGVFGYVLVRKLRAYRRAYQR-------TTVRK-DR
12368|hp|hma       TAIAATIY-NVDFLVAFFGFVIVYDSIFGLLLLKKVRAYRQAYTR-------AHEDP-DE
2807|hp|hhi        TAILAGIY-NVNFLVAFFGFVIVYDSFFGLLLLKKVHAYRRAYRR-------AHEDP-DE
                             :      . :*: ::. *  .*  *:. *  :*                 

2625|chp|nrc1      DTLKPAVRRIADDGVGVDPEDYSAASSAPPAESTEES
42|hp|hla          -DVKPEMTEFED-------------------------
1397|hp|hwa        NEVTPDENDITQ-------------------------
27830|hp|hbo       ASMQSEMTEYE--------------------------
754|hp|nph         VAFESELTEFDPDSGQK--------------------
1408|chp|hut       S-LQPELTEFDP-------------------------
12368|hp|hma       TELRPEQTEFDP-------------------------
2807|hp|hhi        TALRPEQTEFDP-------------------------
                     . .