HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0009COG2309arCOG01888 arCOG01889Leucyl aminopeptidase (aminopeptidase T)aminopeptidase homolog

HOG Organism Gene ID Name Annotation
cHOG0009 nrc1 VNG0186 pepB1 aminopeptidase homolog
cHOG0009 nrc1 VNG2449 pepB2 aminopeptidase homolog
cHOG0009 nrc1 VNG2546 pepB3 aminopeptidase homolog
cHOG0009 hmu HMUK0257 Hmuk_0257 peptidase M29 aminopeptidase II( EC:3.4.11.1 )
cHOG0009 hmu HMUK0828 Hmuk_0828 peptidase M29 aminopeptidase II( EC:3.4.11.-,EC:3.4.11.1 )
cHOG0009 hma RRNAC2181 pepB2 aminopeptidase
cHOG0009 hma RRNAC2726 pepB3 aminopeptidase
cHOG0009 hwa HQ1074A pepB aminopeptidase ( leucyl aminopeptidase, aminopeptidase T)
cHOG0009 hwa HQ3641A pepB leucyl aminopeptidase
cHOG0009 hla HLAC2666 Hlac_2666 peptidase M29 aminopeptidase II
cHOG0009 hla HLAC2014 Hlac_2014 peptidase M29 aminopeptidase II
cHOG0009 hbo HBOR29480 Hbor_29480 leucyl aminopeptidase (aminopeptidase T)( EC:3.4.11.-,EC:3.4.11.1 )
cHOG0009 hbo HBOR03780 Hbor_03780 leucyl aminopeptidase (aminopeptidase T)( EC:3.4.11.1 )
cHOG0009 hut HUTA0741 Huta_0741 peptidase M29 aminopeptidase II
cHOG0009 hut HUTA1834 Huta_1834 peptidase M29 aminopeptidase II
cHOG0009 hvo HVO_0242 HVO_0242 pepB Aminopeptidase II
cHOG0009 nph NP0872A pepB_2 aminopeptidase ( leucyl aminopeptidase, aminopeptidase T) 2
cHOG0009 nph NP1140A pepB_3 aminopeptidase ( leucyl aminopeptidase, aminopeptidase T) 3
cHOG0009 hhi 2661 pepB3 aminopeptidase
cHOG0009 hhi 14 pepB1 aminopeptidase
cHOG0009 hhi 4138 HAH_4138 hypothetical protein
cHOG0009 hhi 4112 HAH_4112 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4138|hp|hhi         ------------------------------------------MSDDQL------------
4112|hp|hhi         ------------------------------------------MSDDQL------------
1074|gene|hwa       -------------------------------------------MDDRIHQHASVLVDWSA
741|gene|hut        -------------------------------------------MDDRIHEHAAVLVDWSA
12181|gene|hma      MSPVPYCTKYSSAGTQKIHGIHSHQPCQPGDHRRFVPATLGGDMDDRIREHARILVDWSA
2661|gene|hhi       -------------------------------------------MDDRIREHARILVDWSA
2546|gene|nrc1      -------------------------------------------MDPRVEEHAEVLVDWSA
1140|gene|nph       -------------------------------------------MDERVREHAAVLVDWSA
2666|gene|hla       -------------------------------------------MDERVHEHAEVLVDWSA
3780|gene|hbo       -------------------------------------------MDPRIRDHAEVLVDWSA
186|gene|nrc1       -------------------------------------------MDTRVRRHAEVLVDQCA
2449|gene|nrc1      -------------------------------------------MDSRIRQHAAVIVDRCI
1834|gene|hut       -------------------------------------------MDPRIREHAQLVAD-AL
2014|gene|hla       -------------------------------------------MDARVREHAEIIADHST
3641|gene|hwa       -------------------------------------------MDPRIRDHAQTVIDHST
29480|gene|hbo      -------------------------------------------MDPRIREHAQIIADHSA
872|gene|nph        -------------------------------------------MDARIREHATIIVDHST
12726|gene|hma      -------------------------------------------MDPRIREHAEVIVDHSI
14|gene|hhi         --------------------------------------MVPICMDPRIREHAEVIVDHSI
                                                                * .:            

4138|hp|hhi         ------------------------------------------------------------
4112|hp|hhi         ------------------------------------------------------------
1074|gene|hwa       RITAGDNVVVNVAEGAHNLAVAVADVLGERGASLVMT----YN--SAEVSRAYLRGH---
741|gene|hut        RIESGDDVVLSVDEGAHDLAVAVAEKLGDRGANLVNV----YR--SDEIQRAYLQAH---
12181|gene|hma      RIDAGDDVVVAVEDGAHDLAVAVAEQLGDRGANLLST----YQ--SDELTRAYLQAH---
2661|gene|hhi       RIDAGDDVVVAVEDGAHDLAVAVAEQLGDRGANLLST----YQ--SDELTRAYLGAH---
2546|gene|nrc1      RIEAGDNVVLSVGPDAHELAVAVAERVGERGANLVTT----YA--SGEIDRAYQLGH---
1140|gene|nph       RVDPGDDVVISVAEDAHELAVAVAERLGEVGANVVTT----YG--SAELQRAYLQAH---
2666|gene|hla       RIEAGDDVVVSVAEDAHDLGVAVVEALGERGANATTL----YG--SAEISRAYLKGSEQG
3780|gene|hbo       RIESGDDVVVSVAEGAHELAVAVAEKLGERGANVVTT----YA--SDEVLRAYLRAH---
186|gene|nrc1       DVRRGDMVTIRASRQAEALVVALYEALGQRGARPSLS----WS--LPRATRAYARAM--D
2449|gene|nrc1      DLQPDENVVVSLPPVAEDLRVALYEKIGEVGANPVMLARGDRGIGTDRAARAYLQAI--D
1834|gene|hut       DLSEGDNLLIKSEPAAEDLVVALYEIAGDRGAHPVSM----RTNRSGRAIRSYLQAADAA
2014|gene|hla       DIQSGDDVVIQMPKEAEDLAVALHEICGDRGANPVYL----NY--SKRAQRAFKRSS---
3641|gene|hwa       DIDSGDRVVIGAPAAASDLVIALYEECANRGAHPVSL----QN--DSRATRAFLQNY-TD
29480|gene|hbo      DISDGDNVVINAPAAAEELVVALHEECAERGANPVYM----NN--SSRASRAFLRNH---
872|gene|nph        EVQPGDNVVISAPSEAEDLAVALHEVVGDRGATPVYL----AS--DSRAQRAYLKAT---
12726|gene|hma      DLSEGDNLVIDAHPQAADLVTALHEFAADRGANPLVV----QDRLGERFRRAYLRNR---
14|gene|hhi         DLSEGDNLVIDAHPQASDLVTALHEFAADRGANPLVV----QNRLGERFRRAYLRNR---
                                                                                

4138|hp|hhi         --------------------FIVVEG----------------------------------
4112|hp|hhi         --------------------FMVVEG----------------------------------
1074|gene|hwa       ETDFEPAPAHERALYDAADSVLILGGDRNTTATADVSGDTKQAAAQANKQIREARMSTDW
741|gene|hut        DDDFDDDPEYERTLYENADSVLVLKGTRNTAGMADVPDDRQQAFARAREEVREARLATDW
12181|gene|hma      DGSFTENPDYELALYERADSVLFLKGSRNTTETADVDSDQRQAYSTARQEIREARLDTDW
2661|gene|hhi       NGSFTENPEYELALYERADSVLFLKGSRNTTETADVDSDQRQAYSTARQAIREARLDTDW
2546|gene|nrc1      EGDFDADPAHERALVEHADVCLFIGGGRNTSAAADVPATTREAYNTAHGEIREARMDTDW
1140|gene|nph       DGDFEA-GDHEAALLSAADVYLRLGGGRNTAATADVESETRQAYSRARANIRDARMDTDW
2666|gene|hla       SHGFDDDPAVERALFEAADAYLRIGGGRNTTATADVSSETRQAYAKARKDVREARMDTDW
3780|gene|hbo       DAEFDF-GAHELALYENADSVLFLGGGRNTFATADVPGETRQASDRASQPVREARMDTDW
186|gene|nrc1       EADYTT-KDHELAAMEETDVVFLIGGGPNAFETSDVPPEMSQAGSRAHKPISEQRLDTRW
2449|gene|nrc1      AEDLST-PEHLLQLYEHADAAVVGRPHRNVTEQSDVSTELGAAFAEAHRDVLNARLSTKW
1834|gene|hut       DVDFET-PAHEQALVEAADCHAVIRSHVNVTELEDVAPEVNSDYEKAHQPILNERLTDRW
2014|gene|hla       -DDFTE-PSHRRALYEEADVFIIARGGSNATEDADIDPETNAAYNRAMEDVKRTRLSKTW
3641|gene|hwa       TDDFET-PSHLLALYQEMDTYIAIRGDENATETADVNPETNAAYRRAMQPVLQERLSKTW
29480|gene|hbo      DGEFET-PDHLLAMYEEMDAYIAVRGDVNASETADVDPETNAAHRRAMQPVLEERLSKKW
872|gene|nph        DDDFET-PTHLKALYEETDVLIRVRGEANATEQSDVPPETQAARSKAYQPVQEVALSKRW
12726|gene|hma      -DEFET-PSHIEALYEEMDAYIAIKGSDNVTETSDVDPETTAAYQQSQQPLLNERLSKTW
14|gene|hhi         -DEFET-PSHIEALYEEMDAYIAIKGSDNVTETSDVDPETTAAYQQSQQPLLNERLSKTW
                                                                                

4138|hp|hhi         ------------------------------------------------------------
4112|hp|hhi         ------------------------------------------------------------
1074|gene|hwa       VSTVHPTRALAQQAGMSYTQYQDFVYDAILRDWETLAEEMERLKRCLDDGSELRVVS---
741|gene|hut        VSTLHPTRALAQGAGMAFEEYREFVYDATLRDWESLSEEMDRLKTILDQGDEVHIDA---
12181|gene|hma      VSTQHPTRAMAQQAGMAYAEYKDFVYDATLRDWEALADEQARLKEILDDGSEVRIVA---
2661|gene|hhi       VSTQHPTRAMAQQAGMAYADYKDFVYDATLRDWEALAEEQAQLKDILDDGKEVRIVA---
2546|gene|nrc1      VKTVHPTRSLAQQANMSFAAYQEFVYDAVLRDWEALADRMANMKTILDEGSEVRLVT---
1140|gene|nph       VSTVHPTRSLAQQAGMAYEAYQEFVYNAVLRDWEALAERMATVKALLDDGERVRIVKERD
2666|gene|hla       VSTVHPTRSLAQQAGMAYEEYQEFVYDAVLRDWEALADEMAAMKEALDAGEEVRIVTDRD
3780|gene|hbo       VSTVHPTRSLAQQAGMAYEEYQQFVYDAVCRDWEELADQMANMKEILDEGSEVRLVK---
186|gene|nrc1       VITTHPTAAGAQRAGMSTAAYEEFVYDAVNKDWAAQSEFQSQLVEILDPAETVHIVS---
2449|gene|nrc1      CLTQYPAPADAQLAGMSTAAYEDFVYDAVNKDWDAVEDHQQQMVDILNPAEEVRIVS---
1834|gene|hut       TLTQHPTPADAQLAEMSTEAYENFVYDAILKDWDEQREFQAQLVEILEDASEVRIAS---
2014|gene|hla       CLTQYPTASHAQLAGMSTEAYENFVWDAVSLDWDEQREFQSNMVEILDTADEVRITS---
3641|gene|hwa       CLTQYPTTGNAQLAGMSTEAYENFVWDAVGLDWNAQREHQSQLVDILADADEVRIQS---
29480|gene|hbo      CLTQFPTAGNAQLAGMSTEGYENFVWDAVNLDWDEQYEFQQQMVEILDDADEVHIVA---
872|gene|nph        CLTQYPTQGNAQLAGMSTEGYQNFVWDAVNKDWDAQRRHQEQMVEILDPASEVRIKS---
12726|gene|hma      CLTQYPAPANAQLAQTSTEGYENFVWDAVLKDWDAVREHQAQMVEILDPADEVRIVS---
14|gene|hhi         CLTQYPAPANAQLAQTSTEGYENFVWDAVLKDWDAVREHQAQMVEILDPAEEVRIVS---
                                                                                

4138|hp|hhi         ------------------------VGPADFPENEA-------------------------
4112|hp|hhi         ------------------------VGPADFPENEA-------------------------
1074|gene|hwa       DNGETDLTMSIEHRTAVNSAASVAYDSHNLPSGEVFTAPVETTVSGTVQFDVPMVIRDTR
741|gene|hut        --PGTDLTLSIAGRTAVNSAASVAYDSHNLPSGEVFTAPA--DAEGEVTFDVPMTVRGNT
12181|gene|hma      --DGTDITLFIDGRIAVNSAASVAYDSHNLPSGEVFTAPH--DTAGVVTFDVPMTIQGRR
2661|gene|hhi       --DGTDITLYIDGRIAVNSAASVAYDSHNLPSGEVFTAPY--DTAGVVTFDVPMTIQGRR
2546|gene|nrc1      --EDTDLTMRIAGRQAVNSAASVAYDSHNLPSGEVFTAPT--ATEGEVHFDVPMTLRGER
1140|gene|nph       DQPRTDIQLSIADRTAVNSAASVAYDSHNLPSGEVFTAPA--DADGEVFFDVPMTISDRR
2666|gene|hla       DAPDTDISMSIAGRTAVNSAASVAYDSHNLPSGEVFTAPY--DTEGEAFFDVPMTIDATR
3780|gene|hbo       -GDNTDIRMSIEGRTAVNSAASVAYDSHNLPSGEVFTAPY--DPEGEVFFDVPMTISGSR
186|gene|nrc1       -GDTTDITMRVDGMRACND-----DGDHNMPAGEVFTAPVPDSVAGEVYFDKPLMRQGNE
2449|gene|nrc1      -GDTTDVTMSVADMTTLND-----CGSNNLPAGEVFTAPVPDSVEGEVVFDKPVYHQARE
1834|gene|hut       -GDTTDVTMSVDGNHVIND-----TDTHNLPGGEVFTAPIPDSVEGDVLFDKPVYRRGRE
2014|gene|hla       -GEETDLTMDLSGNSTLND-----YGEANLPGGEVFTAPVRDGVDGEVHFDLPLYRYGRE
3641|gene|hwa       -GSNTDVTMRIAGNTALND-----YGEKNLPGGEVFTAPIKHSVEGEVHFDMPLYRQGRE
29480|gene|hbo      -GDETDVTMSVAGNSTLND-----KGEKNLPGGEVFTAPVKDSVNGEVHFDMPLYRQGRE
872|gene|nph        -GDTTDVTMSLDGMKTLND-----YAEKNLPGGEVFTAPVVDSVEGEVLFDMPLYHQGRE
12726|gene|hma      -GETTDVTMSVTGNETLND-----YGEKNLPGGEVFTAPVPDSVEGEVLFDKPLYHQGRE
14|gene|hhi         -GETTDVTMSIAGNETLND-----YGEKNLPGGEVFTAPVSDSVEGEVLFDKPLYHQGRE
                                                ::* .*.                         

4138|hp|hhi         ----------------SSNKQDEAVA----------------------------------
4112|hp|hhi         ----------------SSNKQDEAVA----------------------------------
1074|gene|hwa       IRDAELTFEDGTVVDYDATAGVETLAQILNTDPGARRLGEVGIGMNRGIDQITNKILFDE
741|gene|hut        LRDVHLVFEDGDVVEHAAAAGEETLAALLETDAGARRLGELGVGMNRGIDRYTDNILFDE
12181|gene|hma      VKNVELTFKDGVVVDWSAEQGEAVIDEIIGTDSGSRQLGELGIGMNRGVDRVTDNILFDE
2661|gene|hhi       VKNVELTFKDGVVVDWAAEQGEGVIGEIIGTDGGSRQLGELGIGMNRGVDRVTDNILFDE
2546|gene|nrc1      VQGVHLTFEDGEVVDYAAAQNEGVVGEILETDAGAKRLGELGIGMNRGIDQFTDSILFDE
1140|gene|nph       VRDVRLVFEAGEVVDYEAAQGESVIESVLETDAGARRLGELGIGMNRGIDRVTDNILFDE
2666|gene|hla       VRDVHLVFEDGEVVDFSAGAGEDALASVLDTDPGARRLGELGIGMNRGIDRFTDSILFDE
3780|gene|hbo       VRNVHLTFADGEVTDFTAESGEDALAEIFDTDDGARRLGELGIGMNRGIDRFTDNILFDE
186|gene|nrc1       IRGAALTFEDGDVVSFSAEQNEDVLAGILNTDAGARRLGELGIGMNRGIDRFTYNMLFDE
2449|gene|nrc1      IQGAALTFEDGEVVSFSAEQNEDVLAAILDTDDGARRLGELGIGMNRDIDRFTYNMLFDE
1834|gene|hut       ITDARLVFEDGEVVEHSASKNEELLTSILDTDEGARRLGELGIGMNRDIDRFTYNMLFDE
2014|gene|hla       IEGVRLRFEDGEVVSHSAERNEDLLTGILDTDEGSRHLGELGIGMNRQIDRFTYNMLFDE
3641|gene|hwa       IEDVRVQFNEGYVESYSAGRNETVLDGIFATDEGARYLGELGIGMNRAIDQFSYNMLFDE
29480|gene|hbo      ISGVRVRFEDGRVESYSAERNEEVLDGVFETDEGARYLGELGIGMNRAIDQFTYNMLFDE
872|gene|nph        ITGAHLVFEDGEVVEHSADQNEGLLTEVLNTDPGASRLGELGIGMNRDIDEFTYNMLFDE
12726|gene|hma      VTDVFLRFEDGEVVEHSAGKNEDLLTEVLSTDDGASRLGELGIGMNRDIDQFSYNMLFDE
14|gene|hhi         VTDVFLRFEDGEVVEHSAAKNEDLLTEVLSTDDGASRLGELGIGMNRDIDQFSYNMLFDE
                                     :      :                                   

4138|hp|hhi         -LANDIHDLIREEYGKEEIEG-------------VIPVVNPDAHEQMQATEL--------
4112|hp|hhi         -LANDIHDLIREEYGKEEMEG-------------VIPVVNPDAHEQMQATEL--------
1074|gene|hwa       KMGDTVHFAVGRAYDACLPAN--ESGNESAVHVDLITDIGSGAQIEIDDEIIQRNGRFKW
741|gene|hut        KMAETVHLALGRAYDACLPEG--ESGNDSAIHVDLIADTSEDATLSVDGEVIQRDGVFRW
12181|gene|hma      KMGGTVHLALGRAYDACLPEG--ESGNDSAVHEDLITTMGEGSRLEVDGETIQRDGVFRW
2661|gene|hhi       KMGGTVHLALGRAYDACLPEG--KSGNDSAVHEDLITTMGEGSRLEVDGETIQKDGLFRW
2546|gene|nrc1      KMGDTIHLALGRAYESNFPAGSEDEANESAVHVDMITDVSEDSYMEVDGEVVQRNGTFRW
1140|gene|nph       KMGETAHLALGRAYDANLPDG--ESGNDSAVHVDLITDLSEASRIEVDGDVVQRNGVFYF
2666|gene|hla       KMGDTIHLAVGRAYDACLPEG--ESGNDSAVHVDMISDVSENSRMEIDGEVVQRNGTFRW
3780|gene|hbo       KMGDTIHLAVGRAYGSCLPEG--ESGNDSAVHVDMITDVSEESRMDVDGEVVQRNGVFRW
186|gene|nrc1       KMGDTVHLAVGGAIDECVPED--CEFNDSAVHTDMIVDMSEDSFIEIDGEIVQRNGTFVF
2449|gene|nrc1      KMGDTVHMALGRAYPETVGEG--VEQNDSAKHVDMIVDMSEDSFIEVDGEIVQRNGTFVF
1834|gene|hut       KMGDTVHMAVGRAYEDNVGVG--NEQNESAQHVDMIVDMSEDSFIEVDGEVVQEDGTFVF
2014|gene|hla       KMGDTVHMAVGSAYPETVGEG--NEVNESAEHVDMIVDMSEDSVIEVDGEVVQRNGTFVF
3641|gene|hwa       KMGDTVHMAVGSAYAETVGED--NERNESAEHVDMIVDMSEDSTIEVDGEIIQRNGTFIF
29480|gene|hbo      KMGDTVHMAVGSAYPETVGEE--NEENESAEHVDMILDMSEDSIIEVDGEVVQRNGTFVF
872|gene|nph        KMGDTVHMAIGRAYDECVGED--REANESAVHLDMIVDMSDDSVIEVDGEVVQRDGTFRF
12726|gene|hma      KMGDTVHMAVGRSYDETVGED--NEQNESAVHVDMIVDMSEDSFIEVDGEVVQRNGTFIF
14|gene|hhi         KMGDTVHMAVGRAYDETVGED--NEQNESAVHVDMIVDMSEDSFIEVDGEVVQRNGTFVF
                     :.   *  :                        :*   .  :  .::   :        

4138|hp|hhi         -----------
4112|hp|hhi         -----------
1074|gene|hwa       DPEFDPSGV--
741|gene|hut        EDGF-------
12181|gene|hma      EDGFEG-----
2661|gene|hhi       EDGFEG-----
2546|gene|nrc1      EDGFSE-----
1140|gene|nph       EDGFEAAKRPD
2666|gene|hla       EDGFDG-----
3780|gene|hbo       EDGFEG-----
186|gene|nrc1       EDGFEA-----
2449|gene|nrc1      EDGFDA-----
1834|gene|hut       EDGFKG-----
2014|gene|hla       EDGF-------
3641|gene|hwa       EEEF-------
29480|gene|hbo      KDDFE------
872|gene|nph        EDDFEA-----
12726|gene|hma      EDGFED-----
14|gene|hhi         EDGFEA-----