HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0089arCOG01771hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0089 nrc1 VNG0858 vng858 no entry
tucHOG0089 hmu HMUK2487 Hmuk_2487 Rhomboid family protein
tucHOG0089 hma RRNAC0415 rhoM putative intramembrane serine protease
tucHOG0089 hwa HQ1869A rhomboid family protein/intramembrane serine protease
tucHOG0089 hla HLAC1491 Hlac_1491 Rhomboid family protein
tucHOG0089 hbo HBOR17590 Hbor_17590 uncharacterized membrane protein
tucHOG0089 hut HUTA0530 Huta_0530 Rhomboid family protein
tucHOG0089 hut HUTA1671 Huta_1671 Rhomboid family protein
tucHOG0089 hvo HVO_1474 HVO_1474 rhomboid-like intramembrane serine protease
tucHOG0089 nph NP2230A homolog to rhomboid protein
tucHOG0089 hhi 1218 rhoM putative intramembrane serine protease
MUSCLE (3.6) multiple sequence alignment


1671|gene|hut       -----------------------MIP------WM-------VL-----------------
530|gene|hut        MSAMVLALAPLPLTTSGIRATIDAVP-----LWA----WQLVL-----------------
858|chp|nrc1        MHVPSDAAAVVALTAVGGVLAVSVVPRFRRARWLAGAAVSGVLAGLVVAGSSGLLDLWRA
2230|gene|nph       ----------------------MPLP-----AAV----WYPVL-----------------
10415|gene|hma      ---------------MMQSLPTPAVP-----AWL---PWQEAV-----------------
1218|gene|hhi       ---------------MMQSLPTPAMP-----AWL---PWQEAV-----------------
1491|gene|hla       -----------------------MVA-----EALSSNTVHLVA-----------------
1869|gene|hwa       ---------------------MVYQL-----GFLSPPTLQRLV-----------------
1474|gene|hvo       ---------------------MLEIP-----GWI---PFQRLA-----------------
17590|hp|hbo        ----------------------MEIP-----GVL---TVQRAA-----------------
                                                                                

1671|gene|hut       ---LAAVVVFSGGYWWFVGGR--------GRWVSLTRDRFVRGVPWATLVTAALVVGFYL
530|gene|hut        ----AAGILLSVGILYRIARPR-------GRWGQRLRSRFVLGLPWGTLLGLAFVVCVYL
858|chp|nrc1        VGYAAVVVLLATGTAVFTRGPG-------QDAVQAVRSRLLFGVPWGTLLVAGIVAGFYT
2230|gene|nph       ----AAALAVSLAAVYYLSQPA-------GRWGQLVRKRLLLGLPWGTLLAVGGVLAFYL
10415|gene|hma      ---VLVVVLAVLLTICRVSD---------MRLGDGLRERLLLGAPWGTLLTIAGVAAVYL
1218|gene|hhi       ---VLIVVLAVLVAVRRLSA---------ARPGDGVRARLFLGVPWGTLLTMAGVLAVYL
1491|gene|hla       ---GGALVAVALAVVYQADRPR-------GAWTRALRSRFLLGVPWGTLVAIAAVVAVYL
1869|gene|hwa       ---VIAVTAIAVLTIVWIRRTQTHDNGDHGHSGLQLQDRFILGVPWGTILTIVFVSLVYL
1474|gene|hvo       ---ALLALLAAAVALAVVDRP--------SRLSAALRRRFLFGLPLGTLASAGGVLVVYL
17590|hp|hbo        ---LLAAFVLALVVVFFTDRPA-------GRWGTALRRRFVLGVPWGSLITLVGVLAVYL
                                                        . *:. * * .::     *  .* 

1671|gene|hut       FVQGGLGHWSQPLTIPFRSWSLFEPVGLLTSGLAHAGPAHLLGNVTGLVVFGAIVEHAIG
530|gene|hut        FVQGGWGNLRDPVSLPFQATSYAYPLGILTAGFAHLGWSHLFGNLWAGLVFGSIAEFAWS
858|chp|nrc1        LVQRGPDG--TLLVVPFISWSYAYPLGVLTSPIAHANLGHVTGNLIGTLALAPVAEYAFS
2230|gene|nph       LAQDGLANPNAPVQIPFRAYGYTYPLGVLTAGFAHASLGHLVGNLIGTLVFGSLAEYAWS
10415|gene|hma      FLQGAWWHPRNPLVTPFRTWSYFYPFGMLTGAFTHGSQGHITGNLMGTLVYGTVAEYVWG
1218|gene|hhi       FLQGAWWHPRNPLVTPFRTWSYFYPFGMLTGAFTHGSQGHITGNLMGTLVYGTVAEYVWG
1491|gene|hla       FVQSGLENPNRPVVIPFRSWSYFYPEGMLWSGLAHSGRSHITGNLLSTLVAGALAEYAYG
1869|gene|hwa       FLQDGLTHWRRPITIPFRAWSYFYPLGMLTAAFTHNGPGHLFGNLFGTLAVAPLAEYAWG
1474|gene|hvo       VVQDGWSSWYRPVVIPFRAWSYFYPTGMLTAAFAHSSAGHLVGNLVGTLTLAPVAEYAWS
17590|hp|hbo        FVQGGLHHWNRPLTIPFRAWSYFYPLGVVTAAFSHNGPGHLIGNLTATAMFAPVAEYAWG
                    . * .       :  ** : .   * *:: . ::* . .*: **: .    ..:.*.. .

1671|gene|hut       HYPGDR----------------------------------------------DDTASRRW
530|gene|hut        HYPTER----------------------------------------------GSESFSSW
858|chp|nrc1        HYPTAR----------------------------------------------GTAAFGSW
2230|gene|nph       HFPTER----------------------------------------------GSTSFSSL
10415|gene|hma      HYPRKR----------------------------------------------GVQTFTSL
1218|gene|hhi       HYPRKR----------------------------------------------GVQTFTSL
1491|gene|hla       HFPDSREIDDEPGPVRSALSSAGSSSATVSLTSLPSRASLPSRASIRKSLAVGSVSRESL
1869|gene|hwa       HFPHAR--------------------------------------------RAQSSSYSSI
1474|gene|hvo       HYPTRR----------------------------------------------GSTSFGSA
17590|hp|hbo        HFPRER----------------------------------------------GSTSFGSW
                    *:*  *                                                 :    

1671|gene|hut       NRLRHPGVR-ILLISLGMIGLAVVPSPFVLGWVLGYSGAVYALAGFALVTRPLAAVLAIV
530|gene|hut        H--RHPFVRIGIVF-VTILLTGLVTAAFSWGPIIGFSGVTYAMAGFALVFYPITTLVALV
858|chp|nrc1        R--TNPYVRAGVVFPAGVLAVALLTSVFSWGAAVGFSGVVFAFAGFALLKYPLATVVAVA
2230|gene|nph       R--MNPFAR-IAAFAAAVFAFGIVSAAFGLGPVIGFSGVVFAFVGFALVRFPLATAVATL
10415|gene|hma      R--TNPFAR-ILAVPAAMFVVGVFSAVFAIGPIVGFSGVVFAIAGFALVTRPTLFLGAFL
1218|gene|hhi       R--TNPLAR-ILAVPVAMFVVGVFSAVFAIGPIVGFSGVVFAIAGFALVTRPTLFLGAFL
1491|gene|hla       A--TNPYVRAFVVVPGAMLSFGVLASLFALGPVIGFSGVVFALWGFALVFYPVTTIAALT
1869|gene|hwa       R--MNPYAR-VLAVPCTAVIVGLIGTVFGLGPVIGFSGVVFAFVGFAVIIYPLGTALALI
1474|gene|hvo       R--ENPYVRSLVVFPAVVFGVGLLTAVFALGPVVGFSGVVFAFAGFALVFRPLATVLAFV
17590|hp|hbo        R--TNPYVRAFLIVPLVVFVAAILTAAFALGPIIGFSGAVFAFAGFALVNYPLVTVIALV
                        :* .*    .    .  .:. : *  *  :*:**..:*: ***::  *     *  

1671|gene|hut       AHDALGVLVDAAEQPVVEATRSVGPPTPPAWAGIAFQGHLLGFLIGILLGIGLLRRYD--
530|gene|hut        GWSRLWHVYSAFVSPYSVAEAQVRYDTV-GWASTAIQGHAFGFLLGVFVAALLLRRRR--
858|chp|nrc1        ARDAISVFWRTLLEPVTFASASQSFGPP-WWAGVAVQGHLFGFLLGALAAVAVLVHRD--
2230|gene|nph       TTGVVSQLYNAVRSPESVHVASETFSQP-WWAGISLQGHLLGLLAGAVFGAALLYRRG--
10415|gene|hma      GNRVLDLLYSALRYPVSTASGQTRFVTP-WWSNIAIQGHAIGILAGVVVALALLWRRD--
1218|gene|hhi       GNRVLDLLYSALRYPVSTASGQTRFVTP-WWSNIAIQGHAIGILAGVIVALALLWNRD--
1491|gene|hla       GATLVNVTYETLRNPVVVSEASGSYGAP-SWANIAIQGHAIGLIAGILAAVWLVRRRRRR
1869|gene|hwa       GADAIGVFITAVQSPTLTAGGRSAYLSP-WWADIAIQGHALGLLMGVLLGLVVIRSRQ--
1474|gene|hvo       SGRVVSLFYNVMLSPEVVSSARPVFSTP-WWSQIAIQGHAIGFLFGVLLGAWLSHRRG--
17590|hp|hbo        GSRATRVVYNALQTPQLTASGHPAYITP-WWADIAIQGHALGLFIGVFLGLVVVRNRP--
                              .   *               *:  :.*** :*:: * . .  :       

1671|gene|hut       ---------WTPEPVRLFGAVIAFALTKSLWLVVSSGGEGVYVLYRGAGVVMVLLGTLLV
530|gene|hut        ---------RTGHPERIWLAAVIYGIANGLWRVYWFLGGGQYVQFKAVGTALVLVLAGLI
858|chp|nrc1        ---------DHPNPARVWLGAVVIATSLSLWAVWWYGRSAEYVLFRAGGLLLVVVLAVVF
2230|gene|nph       ---------VRPNPTHIWLAALVFAVDRGLWAVYLPEGPETFRLFRALGLAAVFCIAALV
10415|gene|hma      ---------ERPDTLRVFFATLVFAVAQGLWAVYIPLGGGRFRLFRWAGTALVFVLALVV
1218|gene|hhi       ---------ERPDTLRVFFATLVFAVAQGLWAVYIPLGGGRFRLFRWAGTALVFVLALVV
1491|gene|hla       ETTEWIDPESRTSALVAFGAILLFGGSRRLWAIYWYLGSERYELYRAIGLGLLTVLAAIV
1869|gene|hwa       -----LDEQSRPRALRLWVGVVLVGIQQSLWAVYWYRGGDTYVLYRAVGVALVIILAVVV
1474|gene|hvo       --------GSNPPALRSFAGVLLFAVSESLWAVYWYRGGETYVLFRAVGFALVVALATIV
17590|hp|hbo        -------SAERPSALKLWTGVLLFGIQQSMWAVYWFRGGETYVLYRAVGVALVVTVAVII
                                 .   : . :  .    :* :        :  :.  *   :   : :.

1671|gene|hut       TLAATGARPEISAPRALPALSWQPDIDTG-VIPGALRRRVAAVSMPTWVREVLIVGLAFV
530|gene|hut        VAAVAG---------------PDRSAVSRLATGDRSSDS---------------------
858|chp|nrc1        AVVAGT---------------HGGVTLPGRGGETTATAR---------------------
2230|gene|nph       AGAAVA---------------TPRDLLSR----IDLSRR---------------------
10415|gene|hma      AAATIG---------------SGRRLRPS------FDRR---------------------
1218|gene|hhi       AASTVG---------------SDREFRPG------FDRR---------------------
1491|gene|hla       ALAIAG---------------RDEPIRPDLAVPEPETIR---------------------
1869|gene|hwa       TIAVMTNLNSRIHAGTNTNTDTDPPVSRDDKSENHGLNG---------------------
1474|gene|hvo       ALTVAA---------------SDKPLRAS-PDNSLFSAR---------------------
17590|hp|hbo        AVTVVA---------------SDRYILRD-TLGGAFAVR---------------------
                    .                                                           

1671|gene|hut       AYVLVEPTSELAAKALALGVVAGSGYLVLKLLKWALGHLIAAVPTGGWLGRVPVPSIPRP
530|gene|hut        ---------------------------------------------------------PRR
858|chp|nrc1        ------------------------------------------------------------
2230|gene|nph       ------------------------------------------------------------
10415|gene|hma      ----------------------------------------------------------PA
1218|gene|hhi       ----------------------------------------------------------PA
1491|gene|hla       ---------------------------------------------------DGVRSATPA
1869|gene|hwa       ----------------------------------------------------------KW
1474|gene|hvo       ----------------------------------------------------------RW
17590|hp|hbo        ----------------------------------------------------------RW
                                                                                

1671|gene|hut       GKATGTLLGALAVVALLGLLFSPATVSTASL---ADTGEVEIQDYTITYAENVSEGRALT
530|gene|hut        LAAASVLLAVLITMSMVGAMVNLAAPAGGGL---PDDA-VELKDYEIAYAENVTNQQIAV
858|chp|nrc1        KLAAAALIIPVVTMAFVAVPVNLTTVQDANV---AQSA-VSVNGYEVTYAENATNKRVAA
2230|gene|nph       EAAYGLLIAALLAVALVAVPLNLYTIDDPDAGLDADSG-IEVEDYTVYYAEDVENQFVPA
10415|gene|hma      SLAVMVLLVVLGALSLAAVPTNVVDLQADQL---PEDG-IEVRDYVVTYDENVPNAYFDG
1218|gene|hhi       SLAVVVLLVVLGALSLAAVPTNIVDLEDDQL---PEDG-IEVGDYVVTYDENVPNAYFES
1491|gene|hla       AIGLLLLVSALAIVAGPGIAPNLVAVDDDEL---PGDP-IEVSGYQVTYAENVEDRVVSV
1869|gene|hwa       RVATGVLLITTAALAGPAIPYNLYTTDNESL---PGDT-VVVRDYKLTYAEGVENGLVSA
1474|gene|hvo       QAGLAVLLVVVAALSGPAMLYNTFTASGDDL---PGES-VTVRDYEVTYAEDVPNGLTAV
17590|hp|hbo        QTGAACLILVAAAISGPAVPYNLYTATDGDL---PGDE-ISVGDYEVTYAENVTNGMTAA
                      .   *:     ::  .   .            .    : : .* : * *.. :     

1671|gene|hut       WDSEIFDGTSS------GVIVASERRAVWIEAVSPDRLAHDGSATVRVGGLDWEQTVDVE
530|gene|hut        FDLPYLDQATQ--VRTSGVIVTSEKRHLWRVAISKRALEARGSGRVLVGGVGWRSSLWAT
858|chp|nrc1        VDIPYSGAATN--VSASGVIVANPDRGMWTERVGTDELAFRGDAAITVGGLNWRETVGVH
2230|gene|nph       IPVPGDGNVTADRIEASGIIIVSAERDIWWQEVSKSRLASNGEATLRLGSLTWNEDVHVT
10415|gene|hma      IWVPTQRGGAS--VNESGVIVASAEREVWIAAIQPGQLAVDGQERVTVGGPTWRESVYAN
1218|gene|hhi       IWVPTQREGAS--VNASGVIVASAEREVWIAAVQPGRLAVNGKERVTVGGATWRESVYAN
1491|gene|hla       VEMEAFGRSTS--VNTSGVIVANADREIWTTAVSKGNLAFWGYRAVDVGGTGWRETVWVQ
1869|gene|hwa       FNLTAFGETTT--VTTSGVIIQSADRGIWTTAVSTGRLAFAGQSTVSLGGPGWRTPVHIS
1474|gene|hvo       FDVELFGESTT--TNTSGVIVKSERRGIWTTAVSTSRLAFDGESAVRVGGLGWRDRVTAV
17590|hp|hbo        FELSALGETTA--VKTSGVIVRSRERGIWTTAVTRGRLAFDGQTAVRVGGLGWRDTVYTV
                             :       *:*: .  * :*   :    *   *   : :*.  *   :   

1671|gene|hut       RQAVSVVGNDSVYAVDLRTEG----------------STTRSFRSAPATAGARIDGRRVA
530|gene|hut        RSGWSVVGGNSTYRVFFDPKDR---------------EKRLVHTSSPAVADLTLANRTIE
858|chp|nrc1        REGWVATGGQPVYNVYLRPPDGG--------------SLRPVFASANRTAAPVLDGRHVR
2230|gene|nph       RPTWRVAGTESSYLVEAQAETAD--------------ERSVLFQSPPAQADARLDGRNVS
10415|gene|hma      RVDWSVLGNSSVYRVQLRREGG---------------QPRTAYTSEPLTADVILDGRNVT
1218|gene|hhi       RTDWSVLGNDSVYRVQLRREGG---------------QPRTAYTSEPSTADVILDGRNVT
1491|gene|hla       RTGWVAANGGPTYRVDAVRNE----------------TRSTLFTSEPARAEPRIDGRNVT
1869|gene|hwa       RTGWTAGGNGTAYRVNASIGNAPTTNRDADKTTKQLRSQTVLYLSDPVTAAPQLANKTVT
1474|gene|hvo       RDGYVVTGAGVAYRVFLVADG----------------EARLAYETGPVRAGPVVARRNVS
17590|hp|hbo        RDGWVTTQGGTAYRVFLSHNN----------------TARVVHTSEPATAGPVIGGRNIS
                    *    .      * *                           . :    *   :  . : 

1671|gene|hut       VAPTADGFELRVRRNGTVVGSRPLPAANASTSVGSLRFVASEENETRTIRAVSGTTSVRI
530|gene|hut        LRPASDAFEVAIKRDNRTVDKVAIPEDGATTTVDGVTV----TRSGRDLYASIDGTSIRI
858|chp|nrc1        LNADAGQFSLTVLRNETALATTGVPAANATATAGGLTF----EHTAGRLLAHTGNTTVTV
2230|gene|nph       VAPADSGFELRVTRDNETLGTAAVPADGESVTAGGVQF----ERDDRSLFAERGDTRLRI
10415|gene|hma      VAARQNGFDVVVTQGNETVGQAPLPANMTQTRIGGLTF----ERNRSRLYAETDGTRVKI
1218|gene|hhi       VAAQQNGFDVSVTRGNETVGQAPLPANMTRARIGGLTF----ERNRSRLYARTDGTRVKI
1491|gene|hla       VAAVEGGFELRVEGDGGETEIAPLPAVNESVTLREVTF----VRENNAVFAERRETRVRI
1869|gene|hwa       IVPKKTTYELRVNASNR-TKTAPLPPTNTSVTISGLQF----ERKSKIIYVSYEQTRIAL
1474|gene|hvo       VVPTPTGYDVQVSSDSGTV-RGPMPTGNTTTTLDGIRF----VRENSLVFAESRGTKVRI
17590|hp|hbo        IEAAAQGFYLRVKQGNESV-AARLPENNQTVTLDGLTF----AREKQNLFVEYDETRVKI
                    : .    : : :  .        :*     .    : .     .    : .    * : :

1671|gene|hut       ASVERPATS-
530|gene|hut        ANRQVPPTRR
858|chp|nrc1        AHSESYD---
2230|gene|nph       AQRADRS---
10415|gene|hma      AERRQQAAQS
1218|gene|hhi       AERRQQAARS
1491|gene|hla       AQRERYEGRQ
1869|gene|hwa       FEAETYN---
1474|gene|hvo       ARQETYN---
17590|hp|hbo        AKREQYQ---