HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0088COG0702KOG4288 KOG1203 KOG4039arCOG03015Predicted nucleoside-diphosphate-sugar epimerasespossible epimerase

HOG Organism Gene ID Name Annotation
cHOG0088 nrc1 VNG2488 epi possible epimerase
cHOG0088 hmu HMUK1068 Hmuk_1068 NmrA family protein
cHOG0088 hma RRNAC2178 rfbB3 dTDP-glucose-46-dehydratase
cHOG0088 hma RRNAC2896 hypothetical protein
cHOG0088 hwa HQ2335A nucleoside diphosphate sugar epimerase
cHOG0088 hla HLAC0008 Hlac_8 NAD-dependent epimerase/dehydratase
cHOG0088 hbo HBOR01260 Hbor_01260 predicted nucleoside-diphosphate sugar epimerase
cHOG0088 hut HUTA0462 Huta_0462 NAD-dependent epimerase/dehydratase
cHOG0088 hvo HVO_0096 HVO_0096 dtdp-glucose-46-dehydratase
cHOG0088 nph NP0704A nolA_2 NADH dehydrogenase 32K chain-like protein
cHOG0088 hhi 2656 rfbB dTDP-glucose-4,6-dehydratase
cHOG0088 hhi 162 HAH_0162 NmrA family protein
MUSCLE (3.6) multiple sequence alignment


2335|gene|hwa       MKILVAGATGFVGRRLVRALHDQNHDVIAFSRSASEAGFPSGVEPFEGDFGDPA------
12178|gene|hma      MRVLVMGATGFIGRRLVRALDDAGHDVVAFSRSASEESFPEGVEPFEGDLGEPD------
2656|gene|hhi       MRVLVMGATGFIGQRLVHTLAEAGHEVVAFSRSASEESFPDGVEPFEGDLGEPD------
12896|hp|hma        MHVLVTGATGFVGSHLVPALLAAGHSVRALVRDPSEYDPPDGVDVATGDLLDAG------
162|gene|hhi        MHVLVTGATGFVGGHLAPALLAAGHSVRVLVRDPSEYAPPDGVDVATGDLLDAG------
2488|chp|nrc1       MGVLVTGATGFIGGRLTPALAGAGYDIRALVRDADGYDPDTSVDVAEGDLLDPA------
8|gene|hla          MRVLVTGATGFVGSRLVPALLDRGHEVVVLVRDADDYAPPAGVHVVEGDLLEPN------
462|gene|hut        MRVLVTGATGFVGSELVPALREAGHDVVAMTRDASTYAPPDGVDVIEGDLLEPE------
704|gene|nph        MRVLVAGATGFVGSRLVASLVDHGHDVVALTRDAERYDKPEGVDVVEGDLLDPP------
1260|hp|hbo         MKVLVTGATGFVGSRLVRALLDDGHEVSALVRDASNAELPADVHVIEGDLLETGGFHLVD
                    * :** *****:*  *. :*   .:.: .: *...      .*    **: :.       

2335|gene|hwa       ------------------SLEGMCD--D--VDVAYYLIHSL-TAENFAELDRTYARRFRQ
12178|gene|hma      ------------------SLDGLCD--D--IDVAYYLIHSL-TSENFAELDRRYARRFAD
2656|gene|hhi       ------------------SLDGFCD--D--IDVAYYLIHSL-TSENFAELDRRYARRFAD
12896|hp|hma        ------------------SFDAGLD--G--VNAAYYLVHSMRAGSDYAERDRRAARNFRR
162|gene|hhi        ------------------SFDAALA--G--IDVAYYLIHSMRAGTDYAERDRRAARNFRR
2488|chp|nrc1       ------------------SLAGVFD--G--IDTAYYLVHSMRAGDDFAERDRRAARNFAA
8|gene|hla          ------------------SLRSAFDIDGDPVDAAYYLVHSMDGGPGYEERDRNCAQNFIE
462|gene|hut        ------------------SL-SLPD--G--IDAAYYLVHSLETGDSFADRDRRAAENFVE
704|gene|nph        -----------------------LELPS--ADAAYYLVHSMGAGGDFAARDRRAATSFAE
1260|hp|hbo         DGDTGNGGNADLRESDDRTFEDCLSALG--IEAAYYLVHSMQSGSDFEERDRRAARHFER
                                               .   :.****:**:  . .:   **  *  *  

2335|gene|hwa       RASTAGVDRVIYLSGISGNERDLSPHLASRREVEAVLEGGEYELTVLRAAVIIGRGSASF
12178|gene|hma      SASAAGVDRVVYLSGISGDEENLSPHLASRREVESVLAEGSFDLTVLRAAVIIGPESASF
2656|gene|hhi       SASAAGVDRVVYLSGISGDEENLSPHLASRREVESVLAEGSFDLTVLRAAVIIGPESASF
12896|hp|hma        AADEAGVDRVVYLGGLGEEDETLSEHLRSRREVEFILREGAYDLTTFRAAIIIGAGSASF
162|gene|hhi        AADAAGVDRVVYLGGLGEDDETLSEHLRSRREVEFLLKEGEYDLTTFRAAIIIGAGSASF
2488|chp|nrc1       AADAAGVDRVIYLGGLGEEGTDLSDHLESRREVEAVLAGAAFDLTTLRAAVVVGAGSASF
8|gene|hla          AASTAGVDRVIYLGGLGEDREDLSEHLKSRREVERILGTSDPALTTLRAAIIVGAGSASF
462|gene|hut        AADAADVDRTIYLGGLGEAGDELSEHLKSRQEVEAVLDSGDVDLTTLRAAIIVGDGSASF
704|gene|nph        AAEQAGIGRVIYLGGLGDEGDDLSEHLRSRREVEQVLGERAFELTTLRAAVIVGSGSASF
1260|hp|hbo         GVSAASVERVVYLGGLGEERDHLSPHLRSRREVEYVLGEGDYDLTTLRAAIIIGDGSASF
                     .. *.: *.:**.*:.     ** ** **.*** :*      **.:***:::*  ****

2335|gene|hwa       RIVDDLTDRLPLMVVPTWVRTPGNPIAVDDAVRYLVRLLSVPETRGKIFDIGGPSVLSYE
12178|gene|hma      RIVDDLTDRLPLMLVPKWVRTPCQPIGVDDAISYLVELLDADETRGETYDIGGPSVWSYE
2656|gene|hhi       RIVDDLTDRLPLMLVPKWVRTPCQPIGVDDAISYLVELLGADETRGETYDIGGPSVWSYE
12896|hp|hma        RMIRELTTRLPVMLTPRWVRTDCHPIAIDDVIAYLVDVLDKPETAGETYEIGGPEVLTYA
162|gene|hhi        RMIRELTTRLPVLVTPRWVRTDCHPIAIDDVIAYLVDVLDTPETAGETYEIGGPEVLTYA
2488|chp|nrc1       ELVFQLVDRLPVMITPKWVQTPCQPIAVADVIAYLRGVLETPATAGNTYEIGGPDVLSYK
8|gene|hla          EVIHGLASRLPVMTTPKWVDTLCQPIAIDDVVGYLVGALEEPATADDTFEIGGPNVLTYA
462|gene|hut        RMVRQLVDRLPVMIAPRWLHTECQPIAIDDVVAYLVGVLERPETAGNTYEIGGPEILTYR
704|gene|nph        ELIRQLADRLPVMVTPRWVRTDCQPIYIDDVVAYLVGVLEAPATAGETFEIGGPKVLTYE
1260|hp|hbo         EVIRQLADRLPVMVTPRWVDTECQPIYVDDVVAYLVGVLDAPETAGETYEIGGPDVLTYG
                     ::  *. ***:: .* *: *  :** : *.: **   *    * .. ::****.: :* 

2335|gene|hwa       ELLRMTANVKNK-RVLIIPVPVLTPELSSHWLRLTTDVQYRIARPLAKSMRHPVTVDDDR
12178|gene|hma      SLLKLTAAEKGK-RVFIVPVPVMTPGLSSHWLRFTTDVQYAIARPLAESMRNPVTVDPEM
2656|gene|hhi       SLLKLTAAEKGK-RVFIIAVPVMTPGLSSHWLRFTTDVQYAIARPLAESMRNPVTVDPEM
12896|hp|hma        EILKRTGRLMGSGEPTIVPIPVLTPKLSAYWVALMTDVPSSVARPLIHGLKTPVVADTEA
162|gene|hhi        EILRRTGRIMGTGEPKIVPIPVLTPKLSAYWVGLLTDVPSSVARPLIHGLKTPVVADTEA
2488|chp|nrc1       SMLERTATLAGQ-RLLLVPVPVLTPTLSTYWVDLVTDVPRSVAHPLIHGLKHPVVVTDDR
8|gene|hla          EILRQTRRQLGH-KLWIIRVPVLSPELSAKWLRLVTDVNPYLARSLVEGLRNTVIVEDDR
462|gene|hut        DMLEKTAAILGK-RRYIIPVPVLTPRLSSYWVEFVTDVPKAISRPLILGLKNPVVVTDAS
704|gene|nph        DMLRTVAAQQGH-RLRIVPVPVLSPWLSAHWLRLFTDVPAGVARPLVAGLRNAVTVSERR
1260|hp|hbo         EVLKRVGEHLDR-QTRLVSVPVLTPRLSSYWVSLVTNVPTSVSRPLIEGLKNPVVVRDDS
                    .:*  .    .     :: :**::* **: *: : *:*   ::..*  .:. .* .    

2335|gene|hwa       DLQNVVPIDQTPIKTAINQALTVN-------------------------------
12178|gene|hma      DLQDAVPIDQTPIKDAVRKALAGA-------------------------------
2656|gene|hhi       DLQDVVPIDQTPIKDAVRRSLMAS-------------------------------
12896|hp|hma        -AQAQFAVAPTSFGDAVKLALSE-----------PRSRNAARAAAATGGAGR---
162|gene|hhi        -AQAQFAVDLTPFADAVRLALSE-----------PRSRETAQAAAATGGAGR---
2488|chp|nrc1       -IQDLVDVSLTPFDDAAANALRE------------------RGVAADE-------
8|gene|hla          -IRDLVPIDQTPFEVAVARAINE----------------ANRSEAARSEATRS--
462|gene|hut        -IEEIITLDKTSFEDAVRRAFAS-----------------ESGE-----------
704|gene|nph        -IDEHVEVELTPFDEAVQRALAD----------------GESGGA----------
1260|hp|hbo         -IKRHVEVELTPFDEAVTRALGAVSESDTEPAVEPVETVGEDGSDLESSAGSADT
                         . :  *.:  *   ::