HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0086COG2220KOG3798arCOG00515Predicted Zn-dependent hydrolases of the beta-lactamase foldhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0086 nrc1 VNG0851 vng851 no entry
cHOG0086 hmu HMUK2496 Hmuk_2496 conserved hypothetical protein
cHOG0086 hma RRNAC0400 hypothetical protein
cHOG0086 hma RRNAC3033 metallo-beta-lactamase
cHOG0086 hwa HQ2591A hypothetical protein
cHOG0086 hla HLAC1220 Hlac_1220 hypothetical protein
cHOG0086 hbo HBOR15920 Hbor_15920 predicted Zn-dependent hydrolase of beta- lactamase fold
cHOG0086 hut HUTA2540 Huta_2540 conserved hypothetical protein
cHOG0086 hvo HVO_1626 HVO_1626 metallo-beta-lactamase
cHOG0086 nph NP3152A hypothetical protein
cHOG0086 hhi 1228 HAH_1228 hypothetical protein
cHOG0086 hhi 290 HAH_0290 metallo-beta-lactamase
MUSCLE (3.6) multiple sequence alignment


13033|gene|hma      -----------------------------------------MVQSTWDDWFVRDEIEATD
290|gene|hhi        -----------------------------------------MVQSTWDDWFVHDEIEATD
851|chp|nrc1        MRGDDIDSSAMTLITSYTCPRAVKCPGRTTERLGRGPPTAGMVHSDWGDWLPAA-VAAAD
3152|hp|nph         ----------------------------------------MTIHSDWGDWLPTA-IAAAE
1220|hp|hla         ----------------------------------MHSQESDMTDSDWSDWLPRA-VADAD
2591|hp|hwa         -------------------------------MLDVYIDNMSTIKTDWGSWLPRD-VEAAS
15920|hp|hbo        -----------------------------------------MSVSDWGDWLPRA-VEDAS
2540|chp|hut        -----------------------------------------MVSSDWGEWLPAA-IESTT
10400|hp|hma        ----------------------------------------MTVESDWDDWLPRA-VESAT
1228|hp|hhi         ----------------------------------------MTVESDWDDWLPRA-VESAT
                                                                : *..*:    :  : 

13033|gene|hma      PGDGVVIWYLGCNGFVLR-SQSTTLYIDPYFGTGDPPNLIRMIPVPMDPADATQCDATLV
290|gene|hhi        PGDGVVIWYLGCNGFVLR-SQSTTLYIDPYFGTGDPPNLIRMIPVPMDPADATQCDATLV
851|chp|nrc1        P-DGIAVWYLGCNGVILKASDGTTLFVDPYLGTGDPPRTVRMIPVPFDPRDVSDADAVLA
3152|hp|nph         P-DGLAVWYLGCNGFALKAADGTTVFIDPYLGTGDPPRTVRMIPVPFEPTDVVEADAVLA
1220|hp|hla         P-DTVALWYLGCNGFAIKGSEGTVLWIDPYVGTGDPPRTVRMIPVPFDPDDIDEADAVLA
2591|hp|hwa         P-NTVAIWYLGCNGFFLKGNEGTTIAIDPYVGTGDPPRTVRMIPVPFDPGDITTMDAVLA
15920|hp|hbo        P-DTVSIWYLGCNGFFLKGSDGTTLAIDPYVGLGDPPRTVRMIPVPFDPHDVAEMDAVLA
2540|chp|hut        P-DGVAIWYLGCNGFVLKGAGGTTIFIDPYLGTGDPPRTVRMIPVPFDPRDVRAADAVLA
10400|hp|hma        P-DGLAIWYLGCNGFIVKSSGGTTVFIDPYLGTGDPPRTVRMVPVPFNPEDITECDAVLG
1228|hp|hhi         P-DGLAIWYLGCNGFIVKSSGGTTVFIDPYLGTGDPPRTVRMVPVPFNPEDITECDAVLG
                    * : : :*******. :.   .*.: :***.* ****. :**:***::* *    **.* 

13033|gene|hma      THEHIDHMHPPSYGPLVEDLGADLYAPSASYDS----PDYDGEMRVPDEQRNEIAVGDEF
290|gene|hhi        THEHIDHMHPPSYGPLVEDLGADLYAPSASYDS----PDYDGEMRVPDEQRNEIAVGDEF
851|chp|nrc1        THEHTDHVHGPSQAPLLADTGCSLYAPEASIAVARDDERWQDDYAVTTDQYRRVAVGDTY
3152|hp|nph         THDHTDHTHGPSQAPILTGTDATFYGPPTSVATA---EAWTDEHGVDGNDIAEITEGETL
1220|hp|hla         THEHTDHVHGPSQAPILANTDADFVAPDDSLAVAREEERWTEEWEVDEEAFLEVTEGDEL
2591|hp|hwa         THEHTDHTHGPSQGPILESTDARFYAPDDSIDVARETEAWQDEYDINETQLQVISEGDTI
15920|hp|hbo        THEHTDHVHGPSQAPILESTGAQYYAPDDSLDVALEDEAWVDDYDISEEQFTEVTDGDTF
2540|chp|hut        THDHVDHVHGRSQAPILAETGAEFFAPDASLAVT-DAEGWTDEWDVADDQLSSVSIGDEI
10400|hp|hma        THEHTDHVHGPSQAPILAGTGADYYTTDSGHDVIRE-EAWLENYSVTDDQLHEVTEGDTL
1228|hp|hhi         THEHTDHVHGPSQAPILAGTGADYYTTDSGHDVIRE-EAWLENYSVTDDQLHEVTEGDTL
                    **:* ** *  * .*::   ..    .  .         :  :  :       :: *:  

13033|gene|hma      AVGDFTVHVTGTNDPDAIEPVGYVIEHDAGTFFHAGDSRPAEAFSDVGEQFDIDVGALAF
290|gene|hhi        AVGDFTVHVTGTNDPDAIEPVGYVIKHDAGTFFHAGDSRPAEAFADVGEQFDIDVGALAF
851|chp|nrc1        DIGSFTVHVTPAHDPDAVQPVSYVFEHDAGTVFHGGDTKPADALAEIGAAHDIDVGILAF
3152|hp|nph         EVGSLRIHVEPAHDPDADHPVGYVVEHESGTFFHGGDARPSEDFEAIGGSYDIDLGAVAF
1220|hp|hla         KIGEFTVHVVETEDADATHPVGYVIEHDSGTLFHAGDSKPSASFPALADEFDIDLGILAF
2591|hp|hwa         DIGEFTVHVEYAHDPDSTHPVSYVIEHDTGTFFHGGDTKPHEDFDALGNAYDIDLGVLAF
15920|hp|hbo        EVGEFTIHVEHSYDPDATHPVSYVIEHESGTFFHGGDTKPDEEFEALGEKYDIDLGVLAF
2540|chp|hut        EVGEFTIHVADANDPDAEEPVSYVIQHEAGTFFHGGDARPGA-FESVGGRFDIDLGVLAF
10400|hp|hma        EIGDLTVHVEPANDPDAEHSVSYVFEHDAGTFFHGGDARPGE-FESVGERYDIDAGVLAF
1228|hp|hhi         EIGDLTVHVEPANDPDAEHPVSYVFEHDAGTFFHGGDARPGE-FESVGERYDIDVGVLAF
                     :*.: :**  : *.*:  .*.**.:*::**.**.**:.*   :  :.  .*** * :**

13033|gene|hma      GTVGSIYEPEPDSGVRTKWYMDENEIIEAANQLQLSRLLPSHHDMWQGEAGDPKVLHEHA
290|gene|hhi        GTVGSIYEPEPDCGVRTKWYMDENEIIEAANQLQLSRLLPSHHDMWQGEAGDPKVLHEHA
851|chp|nrc1        GSTGEIPDKQTREPSVTTWYNTETEVVACANALQLDRLVPTHWDMWKGLTADPTALHAHT
3152|hp|nph         GSAGMIPDKETREPKYTQWYSNENMAAEAAAQLQLDRLLPTHWDMWKGLTADPTALRDHT
1220|hp|hla         GSVGRVPDKETGEPVETKWYSDENEIAAAAEDLALDRLIPTHWDMWKGLTADPTALHEHV
2591|hp|hwa         GSIGNIDDKDTGEPVRTKWYATENEIIRAAAALNIDRLLPSHWDMWKGLTADPTALHAHA
15920|hp|hbo        GSIGNIDDKETGEPVRTKWYSTENEAVKAASDLQFDRFLPSHWDMWKGLTADPTVLHHHA
2540|chp|hut        GSVGMVPDAIGEEPVRTRWYNDENMIVEAANELQLDALLPSHWDMWKGMTADPTALYDHV
10400|hp|hma        GTVGMIDDKETGEPTRTQWYNDENMIIEAANELQLDTLIPTHWDMWKGMTTEPTVLHNHA
1228|hp|hhi         GTVGMIDDKETGEPTRTQWYNDENMIIEAANELQLDTLIPTHWDMWKGMTTEPTVLHNHA
                    *: * : :        * **  *.    .*  * :. ::*:*.***:* : :*..*  *.

13033|gene|hma      VSFDYPRVIEPLYIGCSVRLSEPGIRRLDALD
290|gene|hhi        VSFDYPRVIEPLYIGCSVRLGEAGIRRIDALD
851|chp|nrc1        RSMASPQRLDVVEIGDRIDVS-----------
3152|hp|nph         RSFDHPRTLEILEIGDRTSV------------
1220|hp|hla         RSRSHPNQLEIVEIGDRIDL------------
2591|hp|hwa         QSYTFPRVIEIAEIGDRIDI------------
15920|hp|hbo        KSFAYPERLEIIEIGDRVEL------------
2540|chp|hut        RSFPYPKRLDIVEIGDRIDM------------
10400|hp|hma        NSFEHPSTFSIIEIGDRYDLD-----------
1228|hp|hhi         NSFAHPSTLSIVEIGDRYDLD-----------
                     *   *  :.   **    :