HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0085COG0462KOG1448arCOG00067Phosphoribosylpyrophosphate synthetaseribose phosphate pyrophosphokinase

HOG Organism Gene ID Name Annotation
cHOG0085 nrc1 VNG2203 prsA ribose phosphate pyrophosphokinase
cHOG0085 hmu HMUK0911 Hmuk_0911 ribose-phosphate pyrophosphokinase( EC:2.7.6.1 )
cHOG0085 hma RRNAC2630 prsA ribose-phosphate pyrophosphokinase
cHOG0085 hwa HQ3650A prsA ribose-phosphate pyrophosphokinase
cHOG0085 hla HLAC2178 Hlac_2178 ribose-phosphate pyrophosphokinase
cHOG0085 hbo HBOR29570 Hbor_29570 ribose-phosphate pyrophosphokinase( EC:2.7.6.1 )
cHOG0085 hut HUTA0834 Huta_0834 ribose-phosphate pyrophosphokinase
cHOG0085 hut HUTA1544 Huta_1544 ribose-phosphate pyrophosphokinase
cHOG0085 hvo HVO_0233 HVO_0233 ribose-phosphate pyrophosphokinase
cHOG0085 nph NP0606A prsA ribose-phosphate pyrophosphokinase
cHOG0085 hhi 3049 prsA ribose-phosphate pyrophosphokinase
MUSCLE (3.6) multiple sequence alignment


834|gene|hut        ---------------------------------------------MITGTSTAQPIAMEV
1544|gene|hut       ---------------------------------------------MILSGSASQTLAARL
2203|gene|nrc1      ---------------------------------------------MLLSGSSSQSLAAAL
2178|gene|hla       ---------------------------------------------MIVPGSSSQLLAATL
3650|gene|hwa       ---------------------------------------------MIVPGSSSQALASAL
29570|gene|hbo      ---------------------------------------------MIVPGASSQALAAAL
606|gene|nph        ---------------------------------------------MIVPGSDTQELAAAL
12630|gene|hma      MSSASPSPDRTRPTPAAPISRVPVSRATSAYGTETGFSPGSHPPDMIIPGADTQAFAATL
3049|gene|hhi       ---------------------------------------------MIIPGADTQAFAATL
                                                                 *:   : :* :*  :

834|gene|hut        SNILGEPLVELAFDGSVEAAEDVTVGD---DERVVIVGSTTSSQAHLELLELQERAVQRD
1544|gene|hut       ADELGESLGATTTKRFPDDELHVTVTE-PIDERAIIVASTVSSDAHIELLQLQDAARQAG
2203|gene|nrc1      AAATGERLGDVTYDSFPDGEQLVTVPPAVDGERAVIVASTPTSDAHIEVLQLQDAARDAG
2178|gene|hla       AEETGRPLATPTYDRFPDGEGLAAVPD-FDDDEATIVAATDSDAAWVELLQLQDAVREAG
3650|gene|hwa       ATELNKPLAAVTYDQFPDGETLAAVPE-FDGDRAIIVATTDTNDTWVELLQLQDAVIEAG
29570|gene|hbo      ARAIDEPLAAVEYDRFPDGETLAAVPD-FDDDRAIIVATTDSNDAWVELLQLQDAVREAG
606|gene|nph        SAALDEPLAAVEYDRFADGERLVQVPE--TDDRAVVVASTVSDSAHVELLQLQDAARQQ-
12630|gene|hma      AEATGERLGRVEYERFPDGEHVVQVPKAVSGERAVVVASTVDSDAHLQLLQLQDAARESG
3049|gene|hhi       AEATGERLGRVEYERFPDGEHVVRVPEAVSGERAVVVASTVDSDAHLQLLQLQDAARESG
                    :   .  *     .   :    . *     .: . :*.:*  . :.:::*:**: . :  

834|gene|hut        PDEIVTVIGYMGYSRQDKLFNPGEAVSVRAIAKALSPSTDRVYSVNPHNVSVLDYFDVPA
1544|gene|hut       ADEVVTVLPYMGYARQDQTFEPGDIISTRAAARAISTGTDRVLTVTPHEKNVASFFDVPT
2203|gene|nrc1      ASEIITVLPYMGYARQDDAFDPGQPVSARAVARAISTGTDRVLTVNPHEDGVLECFDVPA
2178|gene|hla       AERVTTVIPYMGYARQDESFGDGQPVSARAMARAVSTGTDRVVLVNPHEAGVADFYDVPV
3650|gene|hwa       ATEVITVIPYMGYTRQDRAFKSGHPVSARAMARAISPTTDRVILINPHERSVADFFDGHV
29570|gene|hbo      ATEVVTVIPYMGYARQDKAFEDGHPVSARATAQAVSTGADRVVLVNPHEDDISSFFDGHV
606|gene|nph        AEEVVTVLPYMGYARQDAAFEDGQPVSARAIARAVATGTDRVLTVNPHETAVCDFFDVPA
12630|gene|hma      ASEVITVIPYMGYARQDEAFKPGEPVSSRAMARAISTGTDRVLTVNPHEPAVCDFFDVPA
3049|gene|hhi       ASEVITVIPYMGYARQDEAFKPGEPVSSRAMARAISTGTDRVLTVNPHEPAVCDFFDVPA
                    .  : **: ****:***  *  *  :* ** *.*::. :***  :.**:  : . :*  .

834|gene|hut        EPIDAAPQLAEPLPDDLSDPVFLGPDEDAVWLAESVQETYGEGHVDNFEKIRHSAT-EVE
1544|gene|hut       TVIDGAPRLADPLPADLTDPLFLSTDAAAAPLATSARDAYGAGDSDHLTDATDGER----
2203|gene|nrc1      AGVDAAPQLAAPLPADLTDPVFLSPDHGATDLATSVRDAYGTGVTDHFQKVRHSGS-DVT
2178|gene|hla       ETVDAASVLAEPLPTDLADPLFLAPDEGAIRIAETVRDAYGTGETDYFEKHRDRDTGEIE
3650|gene|hwa       TICDAAPHLAESLPSGLSEPLFIAPDAGAIELATAVRDEYGTGSTDYFEKTRHSGT-DVD
29570|gene|hbo      TIVDAAANLADPLPDDLDDPLFLSPDAGAIDLAESVCDAYGRGDVDYFEKVRHSGT-DVE
606|gene|nph        TPVDAAGRLAEPLPS-LSDPLFLSPDAGAIGLAETVSDAYGDGEVDYFEKTRTSDT-EVE
12630|gene|hma      TNVDAASVLADPLPADLQDPLFLSPDEGAIALATTVRDAYGEGETDFFEKDRDYNTGDIE
3049|gene|hhi       TNVDAASVLADPLPADLTNPLFLSPDEGAIALATTVRDAYGEGETDFFEKDRDYDTGDIE
                       *.*  ** .**  * :*:*:..*  *  :* :. : ** *  * : .          

834|gene|hut        MSADDKDFTDRDVVLVDDMIATGGTMSEAVRLISKQDTNHVYVSCVHPLLVDNALSKLAR
1544|gene|hut       PAPTEETIAGRDVIVVDDIVGTGSTMSGAVAVVADGDAERIFATCVHPVFATGALSKIAR
2203|gene|nrc1      VEPSEIQTAGRDVVVTDDIVATGTTMSEAITALD--DPARVFVATVHPLLAGSARLKLAR
2178|gene|hla       VSPSDAHVEGRDVVVVDDIVATGSTMSESVAVLNDRGAARVLAACVHPMLAANAVTKLRG
3650|gene|hwa       MNITDTNVSTRDVVVVDDIIATGVTMSTAVGHLNDGGAARVYIGCIHPLLARGARTRLER
29570|gene|hbo      ITPSDADATDRDVVIVDDIIATGSTVSQAVNHLNSDGARNVFAACVHPLLVRNARTKLER
606|gene|nph        IEPSDATTTGRDIVLVDDIVATGSTMSTAVAQLT--APARVFVTCVHPMLAANARTKLER
12630|gene|hma      ISPSDAPVEGRDVVLVDDIIATGSTMSESVSVLDDRDAQRVFVSCVHPMLASNALTKLNS
3049|gene|hhi       ISPSDAPVEGRDVVLVDDIIATGSTMSESVGVLDDRDAERVFVTCIHPMLASNALTKLNS
                        :     **:::.**::.** *:* ::  :    . .:    :**::. .*  .:  

834|gene|hut        AGVKSLYATDTIDRSISRVSAAPPIADVL--------
1544|gene|hut       VGAESIYGTDTLERVISDVSVASTIADAL--------
2203|gene|nrc1      AGVEAVYGTDTIECAVSEVSAAPAIADAL--------
2178|gene|hla       AGVDRIVGSDTLERGCSVVSVAPVLADALD-------
3650|gene|hwa       AGIERVIGTDTIEREVSAVSVAPTVAAAIEAVDIETR
29570|gene|hbo      AGIEQIVGTDTVERDVSIVSVAPSVAAAVEAV---TQ
606|gene|nph        AGVDAVYGTDTIERPVSAVSVAPAIAEHL--------
12630|gene|hma      AGVEAVYGTDTLERAVSEVSAAPVLSERLE-------
3049|gene|hhi       AGVEAVYGTDTLERAVSEVSAAPVVAEEL--------
                    .* . : .:**::   * **.*. ::  :